KEGG   Miniopterus natalensis: 107533176
Entry
107533176         CDS       T05883                                 

Gene name
TAF2
Definition
(RefSeq) transcription initiation factor TFIID subunit 2 isoform X1
  KO
K03128  transcription initiation factor TFIID subunit 2
Organism
mna  Miniopterus natalensis
Pathway
mna03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    107533176 (TAF2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107533176 (TAF2)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mna03021]
    107533176 (TAF2)
   03036 Chromosome and associated proteins [BR:mna03036]
    107533176 (TAF2)
Peptidases and inhibitors [BR:mna01002]
 Metallo peptidases
  Family M1
   107533176 (TAF2)
Transcription machinery [BR:mna03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     107533176 (TAF2)
   Coactivators
    SAGA/TFTC/STAGA complex
     107533176 (TAF2)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     107533176 (TAF2)
SSDB
Motif
Pfam: Peptidase_M1_N HEAT_2 Peptidase_M1 RPN2_C SR-25
Other DBs
NCBI-GeneID: 107533176
NCBI-ProteinID: XP_016063246
Position
Unknown
AA seq 1199 aa
MPPTGLEPARMNRKKGDKGFESPRPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANL
NRIKLNSKQCRIYRVRINDLEAAFIYNDPTLEVCHSESKQRNLNYFSNAYAAAVSAVDPD
AGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSC
GYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTI
PTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYP
YSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQSLAQQFFGCFIS
RMSWSDEWVLKGISGYIYGLWMKKTFGVNEYRHWIKEELDRIVAYELKTGGVLLHPIFGG
GKEKDNPASHLHFSIKHPHTLSWEYYTMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLA
STASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRK
RNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNK
KKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYQLRYERDVV
AQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACFCLAKIANSMVSTWTGPPAMK
SLFTRMFCCKTCPNIVKTNNFMSFQSYFLQKTMPVAMALLRDVHNLCPKEVLTFILDLIK
YNDNRKNKFSDNYYRAEMIDALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNME
KLLPSYRHTITVSCLRAIRVLQKNGHVPSDPTLFKSYAEYGHFVDIRIAALEAVVDYTKV
DRSYEELQWLLNMIQNDPVPYVRHKILDMLTKNPPFTKNMESPLCNEALVDQLWKLMNSG
TSHDWRLRCGAVDLYFTLFGLSRPSCLPLPELGLVLNLKEKKAVLNPTIIPEAITGNQET
AVNPSSHTQLVGFQNPFSSSQDEEEIDMDTVHDSQAFISHHLNMLERPSTPGLSKYRPAC
SRSALIPQHSPGGDGTPATKPQWGLELARKGTGKEQSPLEMSMHPVATAPLSVFSKDSAS
SKHGEHHHHHHHEHKKKKKKHKHKHKHKHKHESKEKDREPFPFSSPASGRSARSPSLSD
NT seq 3600 nt   +upstreamnt  +downstreamnt
atgccgcccactggcttagagcccgccaggatgaacaggaagaaaggagacaagggcttt
gaaagcccaaggccgtataaattaacccatcaggtcgtctgcatcaacaacataaacttc
cagagaaaatctgttgtgggatttgtggaactgactatatttcccacagttgcaaacttg
aatagaatcaaattgaacagcaaacagtgtagaatataccgagtaaggatcaatgattta
gaagctgcttttatttataatgatccaactttggaagtttgtcacagtgaatcaaaacag
agaaatctcaattacttttccaatgcttacgcagctgcggtgagtgctgtggatcctgat
gcaggaaatggagaactttgtattaaggttccatcagagttgtggaaacacgttgatgaa
ttaaaggtcctaaagatacacatcaatttttctttggatcagccaaaaggaggtcttcat
tttgtggtacccagtgtagagggaagtatggcagagagaggtgctcatgttttctcttgt
gggtatcagaattccacaagattttggttcccatgtgttgactcatactctgaattatgt
acatggaaattagaatttacagtagatgctgcgatggtggctgtttccaatggagatttg
gtggagacggtgtatacccatgatatgaggaaaaagaccttccattacatgcttaccatt
ccaacagctgcgtcaaatatctccttggccattggaccctttgaaatacttgtagatccg
tatatgcatgaggttactcatttttgtttaccccaacttcttccattgcttaaacatacc
acttcatatctccatgaagtttttgaattttatgaagaaattcttacatgccgataccca
tactcttgctttaagactgtattcattgatgaggcttatgttgaagtggctgcttatgct
tctatgagcatttttagcacaaatctgttacacagtgccatgattatagatgagacacct
ttgactagaaggtgtttagcccagtccttggcccagcagttttttggatgtttcatatcc
agaatgtcttggtctgatgaatgggtactgaagggaatttcaggctatatttatggactt
tggatgaaaaaaacttttggtgttaatgaataccgccattggattaaagaggagctggat
agaatagtggcatatgaactgaaaactggtggagttttactacatcccatatttggtgga
ggaaaagagaaggataatccagcatcccatctacacttttcaataaaacatccccataca
ctctcctgggagtactatactatgttccagtgtaaagctcaccttgtgatgagattgatt
gaaaataggatcagtatggaatttatgctgcaagttttcaataaactgctaagtttggct
agtactgcttcatctcagaagttccagtcacatatgtggagtcaaatgttggtttccaca
tctgggtttttgaaatccatctctaatgtctctggcaaagacattcagccgttaataaag
cagtgggtagaccagagtggagtggtaaaattttatggaagttttgcatttaatagaaaa
cgaaatgtcttggaattggaaataaaacaagattatacatctcctggaactcagaaatat
gtgggaccacttaaagtgacagtgcaggagttagatggatccttcaatcacacattgcaa
attgaagaaaacagccttaaacatgatataccctgccattccaaaagcagaaggaataag
aagaaaaaaattccactgatgaatggagaggaagttgatatggatctttctgcaatggat
gctgattcccctttgctgtggatcaggatagaccctgacatgtcagtgctgaggaaagta
gagtttgaacaggccgatttcatgtggcagtaccagctccgctatgagagggatgttgtt
gcacagcaagagtccatcttagccttggaaaagtttcccactccagcgtcgagacttgcc
ctcactgacatattagagcaagaacagtgcttctaccgagtaagaatgtcagcttgcttc
tgccttgcaaagattgcaaattcaatggtgagcacatggacaggaccaccagccatgaag
tcactctttactagaatgttttgttgtaaaacttgtcccaacattgtgaaaacaaacaac
tttatgagctttcagagttattttctacagaagactatgccagttgcaatggctctattg
agagatgttcacaacctttgtcccaaagaagtcttaacatttattttagacttaatcaag
tacaatgacaacagaaaaaataagttttcagataactattatcgtgcagaaatgattgat
gcccttgccaactctgttacgcctgcagtcagcgtaaataatgaagtccggactttagat
aacttaaacccagatgtgcgactcattcttgaagaaatcaccaggtttttgaatatggaa
aaacttcttccaagttatagacacaccatcactgtgagttgtttgagagccatacgagtg
cttcagaagaatggacatgtgccgagtgacccaactctttttaaatcttacgcagaatat
ggccactttgtggacattaggatagcagctttggaagcagttgttgattatactaaagtg
gacaggagttatgaagaactgcagtggctccttaatatgattcagaatgaccctgtaccc
tatgtaagacataagattctagacatgttgactaagaacccgccatttactaagaacatg
gagtctcccttatgcaatgaagccctggtagatcaactttggaaacttatgaattctggt
acttcacatgactggaggctacggtgtggtgctgtggatttgtactttacactttttggc
ctcagcagaccttcctgtttacccttgccagagcttgggttggttcttaatctaaaagag
aaaaaagctgtcttgaatccgaccataattccagaggccatcacaggcaatcaagaaact
gcagttaatccaagtagccacacacagctagttggatttcagaaccctttttcaagttct
caagatgaggaggagattgacatggacactgttcatgacagccaggcgttcatttctcac
catttgaacatgcttgaaaggccatccacgccagggctctctaaatatcgaccagcttgc
tctcgatcggctttaataccccagcactcaccaggtggtgatggcacacctgccacaaaa
ccccagtggggtctggaacttgcacggaagggaacaggtaaagaacagtcacctttggag
atgagtatgcatccggttgcaacagctccgctctcggtattttctaaggactcggcatcc
tccaaacacggcgagcaccaccaccaccaccaccatgagcacaagaagaagaagaagaag
cacaagcacaagcacaagcacaagcacaagcacgagagtaaagagaaggacagggagcct
ttccctttctccagccccgccagcggcaggtcggctcgctctccctccctctccgactga

DBGET integrated database retrieval system