KEGG   Miniopterus natalensis: 107533789Help
Entry
107533789         CDS       T05883                                 

Gene name
PARP16
Definition
(RefSeq) mono [ADP-ribose] polymerase PARP16 isoform X1
  KO
K00774  poly [ADP-ribose] polymerase 16 [EC:2.4.2.30]
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107533789 (PARP16)
Enzymes [BR:mna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     107533789 (PARP16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP ARTD15_N
Motif
Other DBs
NCBI-GeneID: 107533789
NCBI-ProteinID: XP_016064102
Position
Unknown
AA seq 324 aa AA seqDB search
MQPAGWAAVREAVARDLLAADLRCSLFTSALQSYRRDSALRPFPASYARHDCKDFEALLA
DASKLPNLKELLQSSEDKDKRTWDLLSWILSSKVLTIHNAGKSEFEKIQKLTDAPHTPVP
VPDFLFEIEYCDPANAKFYETKGERELIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEG
TYLTSDLSLALIYSPHGYGWQRSLLGPILSCVAVCEVIDHPDVKCQTKKKDSKEIDRRRA
RIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSQKHAKSRASRQLSWFSSHWFTVMISLYL
LLLLIVSVINSSTFQHFWNRAVKR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcagccggcaggctgggcggccgtcagggaggcggtggcccgagacttgctggccgcg
gatctgcggtgcagtctgttcacttcggccctgcagagctacaggcgggactccgcgctg
cggccttttcccgcatcctatgcccgccacgactgcaaggactttgaggccctgcttgcg
gatgccagcaagttacccaacctgaaggaacttctccagtcctctgaagacaaagacaaa
cgaacctgggatctgctgagctggattttatcctcaaaggtcctgacaatccacaatgca
gggaagtcagagtttgaaaagatccaaaagctgactgatgcccctcacactcctgtcccc
gttccggacttcctatttgaaattgagtactgcgacccagcgaatgccaaattttatgag
accaaaggggaacgagagctaatctacgccttccacgggagtcgcctagaaaacttccat
tccatcatccacaatggcctgcactgccacctgaacaagacatccttgttcggggaaggg
acctacctcaccagtgacttgagcctggccctcatttatagcccccatggctatgggtgg
cagcggagcctccttggccccatccttagctgtgtggctgtgtgtgaggtcattgaccat
ccagatgtcaagtgccaaaccaagaagaaagattccaaggagatagatcgcaggagagcg
agaatcaaacacagcgaagggggcgacatccctccaaagtactttgtggtcaccaacaac
cagctcctgcgagtgaagtacctgctggtgtactcacagaagcacgccaagagcagggct
tcccgccagctgtcctggttttccagccattggtttacggtcatgatatccctgtatctg
ctgctgctgctcatagtgagtgtcatcaactcctctactttccaacacttttggaatcgt
gcggtgaagagatag

DBGET integrated database retrieval system