KEGG   Miniopterus natalensis: 107534515
Entry
107534515         CDS       T05883                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mna03021]
    107534515 (AFF3)
Transcription machinery [BR:mna03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     107534515 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 107534515
NCBI-ProteinID: XP_016065122
Position
Unknown
AA seq 1328 aa
MDATQGAWSKEQVAFCFLEERGDLPAEPTVSGTGEKGRKTNFKWILNAFPSCGVYISYRG
EDILNQRNDSLVVEFQSSASRCRSVYEPDRNVLRRKERERRNQETQQDDGTFNSSYSLFS
EPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGVPKPGVPQAAVNKMDEHFVA
DSRAQPQPSSVCSTASSTPAAVPVQQSKRGAMGWQKAGHPPPDGPQRASKRGHRLIDLNR
SAPPKNPNQKPNHCVSSPPSSPPSPSSNSAQQGSLRTLLGDGVGRQQPRAKQVCSVEVGL
HTQERPPAMGTKHGSSGHCVQNFPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKS
STETSVHCTSYRGVPASKPESTRTKAKLSKFSIPKQAEESRTGETNSCVEEIIREMTWLP
PLSAIQAPGKVEPSKFSFPNKDSQLVSSGHNNPKKGDAEPESPDNGTSNTSMLEDDLKLS
SDEEESEQAAQRTALHALSDSGAVQQAGCRASAPSSKGSSSGSSSSGSSSSSDSESSSGS
DSETESSSSESEGSNKPAHFSSPEAEPASSNKWQLDKWLNKVNPHKPPILIQNESHGLES
SQYYTPGKDQAQDCGKLPDGCQPSLRDKDIKSACKEEQRPRTANKAPGTKGVKQKSPPAA
VAVAVTAAAPPPPVPXXXXXXXXXPTRRSAGKKPPRRTERTSAGDGANCQRPEEPADALG
TSAAIPPEPTKARPCANSRTSHRKELRSSVTCEKRRTRGLSRIVPKSKEFIETESSSSSS
SDSDLESEQEEYPLAKAQAVAAAATDQRLKEAASSVSSGGGPRAPVGSINARTTSDIAKE
LEEQFYTLVPFGRNELLSPLKDSDEVRSLWVKIDLSLLSRIPEHLPQEPGVFSAPATKDA
ESAPPSHPSDIPLEKALPKSKRKRKCDNEDEYREIKKAQGEKEGSSRLTTSAGNTLSANH
CNMNITSLAIPINKNEKLLRSPISPLSDASKHKYSSEDLTSSSRSSGSGLFTSTTSSKKL
KAENQLQAHAADLAKAAHHNSENVLHKSRPQTEPWSPGSSGHRDCKRQKLVFDDMPRSAD
YFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVEL
IRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSS
KAAQAPSPWGAGGKSTGTPSPMSPNPSPTSSVGSQGSLSNTSTLSPSTIVSIPQRIHQMA
ANHVSITNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHW
LRNSAHLP
NT seq 3987 nt   +upstreamnt  +downstreamnt
atggatgcaacccaaggcgcctggagcaaggagcaggtagcattctgcttcctggaggag
aggggggaccttccagcagagcccacagtcagtgggaccggggaaaagggacggaagacg
aatttcaagtggattttaaatgctttcccttcttgtggtgtctacatttcttacaggggt
gaagacatcttaaaccagaggaatgactctctagttgtggaatttcagtcatcagccagc
cgatgcaggagtgtctacgaaccagataggaatgtgcttcggaggaaagagcgagaaagg
agaaatcaggagactcagcaggatgatggcacatttaattccagttattccctcttcagt
gaaccctacaagactaacaagggggatgagctctccaaccggatccagaatactttaggc
aattacgatgaaatgaaagacttcctaacggatagatctaatcagagtcatctcgttggt
gttcccaaacctggggttcctcaggctgctgtgaacaagatggatgaacattttgttgca
gattcaagagcccagccccagccctcatctgtctgcagcactgcatcttccacgccagca
gctgtccccgtgcagcagagtaagaggggcgctatgggctggcagaaggctgggcacccg
cctcccgatggcccacagagagcaagtaagcgcggacacaggttgattgatttgaacaga
tctgctcctccaaagaaccctaatcaaaaacctaaccactgtgtgtcgagccccccgtcc
tcacctccctctccttcttccaactcagcacaacagggctctctcaggaccttgcttgga
gatggtgttggcagacagcagccacgggccaaacaggtgtgcagtgtagaggtgggtctt
cacacccaggaaagaccacctgctatgggtaccaagcacggcagcagtggacactgtgtc
cagaactttcctccatccctggcttcaaaacccagcctggtccagcagaaaccgaccgca
tatgtgcggccgatggacggccaagatcaggctccggatgagtctccgaagcttaagtcg
tccacagaaaccagcgtgcactgcacgtcctataggggagtcccggcctccaagccagag
tccaccagaaccaaggccaagctttccaagttcagcatccccaaacaagcagaggagagt
agaactggagaaaccaacagctgtgtggaagaaataatccgggagatgacctggcttccg
ccactttctgcgattcaggcacctggcaaagtggaaccaagcaaattttcatttccaaat
aaggactctcagctcgtctcctccggacacaataatccaaagaaaggtgatgctgagcca
gagagtccggacaatggcacctcgaatacatcaatgctcgaagatgacctcaagctgagt
agtgatgaagaggagagtgaacaggcagcccagagaaccgctctccacgctctgtctgac
agcggcgccgtccagcaggccggctgcagagcctcggcgccctccagcaagggcagcagc
agcggcagcagcagcagcggcagcagctcgtccagcgactcggagagcagctcgggatcc
gactccgagaccgagagcagctcgagcgagagcgagggcagcaacaagcctgcccacttc
tccagccctgaggctgagcccgcgtcctccaacaagtggcagctggataaatggctcaac
aaagttaatccccacaagccgcctattctgatccaaaatgaaagccacggcctggagagc
agtcagtactacaccccggggaaagaccaagcgcaggactgcgggaaactccccgacggc
tgccagcccagcctgagagacaaggacatcaagagcgcctgcaaggaagagcagcggcca
aggacagctaacaaggccccggggactaagggggtgaagcagaagtccccgcccgcggcc
gtggccgtggcggtgaccgcagccgccccgccgcccccggtcccnnnnnnnnnnnnnnnn
nnnnnnnnnnngcccacgcggaggtctgcgggcaagaagccccccaggcgcaccgagagg
acctctgcgggcgacggcgctaactgccagcggcccgaggagcccgcggatgcgctgggg
accagcgcggccatccctcccgagcccaccaaagccaggccctgtgccaacagcaggacg
agccaccgcaaggagctgcgctcctcggtcacctgcgagaagcgccgcacgcggggactg
agcaggatcgtccccaagtccaaggagttcatcgagacagagtcttcgtcttcgtcgtcc
tcggactcagacctggagtcggagcaggaggagtaccccctggccaaagcgcaggccgtg
gccgccgccgcaactgaccagaggctcaaggaggccgccagcagcgtcagcagtggcggg
ggcccccgcgcacctgtcggctccatcaacgccaggaccaccagcgacatcgccaaggag
ctggaggagcagttctacacgctggtccccttcggccgcaacgagcttctctctccccta
aaggacagtgacgaggtcaggtctctctgggtgaaaattgacctgtccctcctgtccagg
atcccagaacacttgccccaggagcccggagtgttcagtgctcctgcgaccaaggacgct
gagagcgcacctccgagccacccatccgacatacccttagaaaaggctttgccaaagtcc
aagaggaaacgcaagtgtgacaacgaagacgagtaccgggagatcaagaaggcccaggga
gagaaagagggctcttcacgactgaccacctctgccggtaatactttgtccgcgaatcat
tgcaacatgaacatcaccagcttggcaatacccataaataaaaatgaaaaactgctccgg
tcgcccatctcacccctctccgacgcctctaaacacaagtactccagcgaggacttgacg
tcttccagcaggtccagcggcagtggcttgttcacttccaccacctccagcaaaaagctg
aaggctgagaaccagctgcaggctcatgccgcggacctcgcgaaagccgctcaccacaat
tcggaaaacgtgctccacaagtcacggccacagacggagccatggtccccgggctccagc
ggccaccgggactgcaagaggcagaaactcgtcttcgacgatatgccgcgcagtgcagat
tactttatgcaggaagctaagcggatgaagcacaaagcagacgcaatggtggaaaagttt
ggaaaggctttgaactacgccgaagcagccttgtcattcattgagtgtggaaatgcaatg
gaacagggcccaatggaatccaaatctccttacacaatgtattcagaaacagtggagctc
atcaggtatgctatgagactaaaaacccactcaggccccaatgccacaccagaggataaa
caactggctgcattatgttaccgatgcctggctctcctgtactggcggatgtttcgactc
aagagggaccatgccgtaaagtattccaaagcacttatcgactacttcaagaattcatct
aaagctgcccaagccccatccccatggggggccggtggaaagagcaccggcaccccctcc
cccatgtcgcccaacccctcccccaccagctccgtgggatctcaggggagcctctccaac
accagcaccctgtctccttcaaccatcgtcagcatcccccagcgcatccaccagatggca
gccaaccacgtcagcatcaccaacagcatcctccacagctacgactactgggagatggcg
gacaacctggccaaggagaacagagaattcttcaatgacctggatctgctcatggggccg
gtcaccctccacagcagcatggagcacctggtccagtactcccagcagggcctgcactgg
ctacggaacagcgcacacctgccgtag

DBGET integrated database retrieval system