KEGG   Miniopterus natalensis: 107536014
Entry
107536014         CDS       T05883                                 

Gene name
RNPEP
Definition
(RefSeq) aminopeptidase B
  KO
K01260  aminopeptidase B [EC:3.4.11.6]
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107536014 (RNPEP)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     107536014 (RNPEP)
Peptidases and inhibitors [BR:mna01002]
 Metallo peptidases
  Family M1
   107536014 (RNPEP)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_MA_2 DUF4932
Other DBs
NCBI-GeneID: 107536014
NCBI-ProteinID: XP_016067103
Position
Unknown
AA seq 446 aa
MSADTWERKGPNTFFFRMSHPIPSYLVALAIGDLVSAEVGPRSRVWAEPCVVEAAKKEYD
GVIEEFLATGEKLFGPYVWGRYDLLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVII
HEISHSWFGNLVTNANWSEFWLNEGFTMYAQRRISTLLFGTAYTCLEAAAGRALLRQHMD
VTGEENPLNKLRVKIEPGVDPDDTYNETPYEKGFCFVSYLAHLVGDQDQFDAFLKAYVNE
FKFQSIIAEDLLEFYLEYFPELKQKRVDTIPGFEFDCWLNTSGWPPYLPDLSPGDLLMKP
AEELAQLWVAKELDMKAIEAVAISSWKTYQLVYFLDKILQKSPLPPGNVKKLGEMYPKIS
SASNAELRLRWGQIVLKNDHQEDFWKVKGFLQSQGKQKYTLPLYHAMMSGSEAARALAKE
TFAATTSQLHSNVVHYVQQIVAPKDT
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgagtgcggacacctgggagaggaaggggccaaacacgttcttcttccgcatgagccat
cccatcccctcctacctcgttgctctggccatcggagacctggtttccgcggaggtgggg
cccaggagccgggtgtgggccgagccctgtgtggtcgaggctgccaagaaggaatatgac
ggtgtgatagaggaattcctggccacgggagagaagctttttggaccctacgtttgggga
aggtacgacctgctcttcatgccaccttccttcccgttcggagggatggagaacccttgt
ctgaccttcgtcaccccctgcctgctggccggggaccgctccttggccgatgtcatcatt
cacgagatctcgcacagctggtttgggaacctggtcacgaacgccaactggagcgagttt
tggctcaacgaaggcttcaccatgtacgcccagaggagaatctccaccctcctcttcggg
accgcctacacctgcctggaagctgcggccgggcgggcgctgctccgccagcacatggat
gtcacgggcgaggagaaccccctgaacaagctgcgggtgaagattgaaccaggtgttgac
ccggacgacacctacaacgagaccccctacgagaaaggcttctgctttgtctcctacctg
gcccacttggtgggcgatcaggatcagtttgacgcgtttctcaaggcctacgtcaatgag
tttaaattccaaagcatcatagcggaagaccttttggaattctacctggagtacttccct
gagctgaagcaaaagagagtggacaccattccagggttcgagtttgattgctggctgaac
acctcgggctggccaccgtatctccccgatctgtcccctggggacttactcatgaagcct
gcggaagagctggcccagctgtgggtggcgaaggagctggacatgaaggccatcgaggcc
gtggccatctcctcctggaagacctaccagctggtttactttctagacaagatccttcag
aaatcccctctgcctcctgggaacgtgaagaagctgggagagatgtacccaaagatctcg
agcgccagcaacgctgaactgcggctgcgctggggccagattgtccttaagaacgaccac
caggaggacttctggaaggtgaagggcttcctgcagagtcaggggaagcagaagtacacc
ctcccgctgtaccacgccatgatgagtggcagcgaggcggcccgcgccctcgccaaggag
accttcgcggccaccacctcccagctgcacagcaatgtcgtacactacgtccagcagatt
gtggcacccaaggacacctag

DBGET integrated database retrieval system