KEGG   Miniopterus natalensis: 107537440Help
Entry
107537440         CDS       T05883                                 

Gene name
CPT1A
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
mna  Miniopterus natalensis
Pathway
mna00071  Fatty acid degradation
mna01212  Fatty acid metabolism
mna03320  PPAR signaling pathway
mna04152  AMPK signaling pathway
mna04714  Thermogenesis
mna04920  Adipocytokine signaling pathway
mna04922  Glucagon signaling pathway
mna04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107537440 (CPT1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    107537440 (CPT1A)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107537440 (CPT1A)
   04920 Adipocytokine signaling pathway
    107537440 (CPT1A)
   03320 PPAR signaling pathway
    107537440 (CPT1A)
  09159 Environmental adaptation
   04714 Thermogenesis
    107537440 (CPT1A)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107537440 (CPT1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mna03029]
    107537440 (CPT1A)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     107537440 (CPT1A)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    107537440 (CPT1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 107537440
NCBI-ProteinID: XP_016068952
Position
Unknown
AA seq 773 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLRLSHEALKQIYLSGLHSWKKKFIRFKNGIITGVYPASPS
SWLIVVVGVMSTMYAKIDPSLGIIAKINRTLDTTGSMSSQTKNVVSGVLFGTGLWVALIF
TMRYSLKVLLSYHGWMFTEHGKMSRATKVWMGMVKIFSGRKPMLYSFQTSLPRLPVPSVK
DTVSRYLESVRPLMKEADFKRMTALAEDFAVSLGPKLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPLMVNSNYYAMDLLYVVPTHIQAARAGNAIHAFLLYRRKLDREELKPILLLGST
VPLCSAQWERMFNTSRVPGEETDTIQHVRDSKHIVVFHRGRYFKVWLYHDGRLLRPRELE
QQMQRILDDPSEPQPGEAKLAALTAGERVPWARCRQAHFARGKNKQSLDAVEKAAFFVTL
DETEQGYRREDPDTSMDSYAKSLLHGRCFDRWFDKSFTFIVFKNGKIGMNAEHSWADAPI
VGHLWEYVLATDSFQLGYLEDGHCKGDTNPNIPHPTRLQWDIPEECQEVIETSLTSANLL
ANDVDFHSFPFDTFGKGLIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREG
RTETVRSCTVESCSFVLAMVDPSQTLEQRLRKFKIASEKHQHLYRLAMTGSGIDRHLFCL
YVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLERNPQYVSSGGGFGPVADDGY
GVSYILVGENLINFHVSSKFSCPETDSHRFGKHLRQAMTDIISLFGFSPNSRK
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagctcaccaagcggtggctttccagttcaccgtcaccccggacggcatcgac
ctgcggctgagccacgaggcccttaagcagatctatctgtcgggactgcactcctggaag
aagaagttcatcagattcaagaatggcatcatcactggcgtgtacccggccagcccgtcc
agttggctcatcgtggtagtgggcgtgatgtccaccatgtacgccaagattgacccctcg
ctggggataatcgcgaagatcaatcggacccttgacaccacgggctccatgtccagccag
acgaagaacgtggtgagcggcgtgctgttcggcacgggcctgtgggtggccctcatcttc
accatgcgatactccctgaaggtgctgctctcctaccacggctggatgttcaccgagcac
ggcaagatgagccgcgccaccaaagtctggatggggatggtcaagatcttctcgggccga
aagcccatgttgtacagctttcagacgtccctgccgcgcctgccggtcccttcggtgaag
gacaccgtgagcaggtacctggagtcggtgaggcctctcatgaaggaggccgacttcaag
cggatgacggccctcgccgaagattttgctgtcagcctcggccccaaattacagtggtac
ctgaagctgaagtcctggtgggccaccaattatgtgagcgactggtgggaggaatacatc
tacctccgaggccggggcccgctgatggtgaacagcaactactacgccatggacctgctg
tacgtggtgcccacgcacatccaggcggccagggcgggcaacgccatccacgccttcctg
ctgtacagacgcaagctggaccgggaggagctcaagccgattctcctcctggggtccacg
gtcccgctctgctcggcgcagtgggaaaggatgttcaacacgtcgcgggtcccgggagag
gagaccgacaccatccagcacgtccgggacagcaagcacatcgtggtgttccataggggg
cgctacttcaaggtctggctgtaccatgacggccggctgctgaggccccgggagctcgag
cagcagatgcagaggatcttggacgacccctccgagcctcagcccggggaggcaaagctg
gcggccctcacggcgggagaaagggtgccctgggccaggtgtcgccaagcccacttcgct
cgtgggaagaacaagcagtccctggacgccgtggagaaggcggcgttcttcgtgaccctg
gacgagaccgagcaggggtacaggagggaggacccggacacgtccatggacagctacgcc
aagtccctcctgcacggcaggtgcttcgacaggtggtttgataagtctttcacgtttatc
gtcttcaaaaacgggaaaataggcatgaacgccgagcactcctgggccgacgcacccatt
gtggggcacctctgggagtacgttttggccaccgacagctttcagctgggctatttggag
gacgggcactgtaaaggggacaccaacccgaacattccacaccccacccggctgcagtgg
gacatcccggaggagtgccaagaggtgatcgagacgtccctgaccagcgccaacctcctg
gccaacgacgtggacttccattcctttcctttcgacactttcgggaaggggctgatcaag
aagtgccgcaccagccccgacgcattcgtccagctggccctgcagctggcgcactacaag
gacatgggcaagttctgcctcacgtacgaggcctcaatgacccggctcttccgcgagggc
aggacagagaccgtgcggtcctgcaccgtcgagtcctgcagcttcgtgctcgccatggtg
gacccctcccagacgctggagcagagactccgcaagttcaagattgcgtcggagaagcac
cagcatctgtaccgcctggcgatgaccggctcgggcattgaccggcacctcttctgcctg
tacgtggtgtccaagtacctggccgtcgagtcccccttcctgaaggaggtcttgtccgag
ccttggaggttgtcgaccagccagacccctcagcagcaggtggagttgttcgatttggag
aggaatccgcagtatgtgtccagcggagggggctttgggccggtcgccgacgacggctac
ggcgtgtcctacatcctggtgggagagaacctcatcaatttccacgtttcctccaagttc
tcctgccccgagacggattctcatcgcttcgggaagcacctgagacaggcgatgaccgac
atcatcagcctgtttgggttcagccccaactccagaaagtaa

DBGET integrated database retrieval system