KEGG   Miniopterus natalensis: 107537716Help
Entry
107537716         CDS       T05883                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate receptor 1 isoform X1
  KO
K05197  glutamate receptor 1
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04713  Circadian entrainment
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna05014  Amyotrophic lateral sclerosis (ALS)
mna05031  Amphetamine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107537716 (GRIA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107537716 (GRIA1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107537716 (GRIA1)
   04728 Dopaminergic synapse
    107537716 (GRIA1)
   04720 Long-term potentiation
    107537716 (GRIA1)
   04730 Long-term depression
    107537716 (GRIA1)
   04723 Retrograde endocannabinoid signaling
    107537716 (GRIA1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107537716 (GRIA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    107537716 (GRIA1)
  09165 Substance dependence
   05031 Amphetamine addiction
    107537716 (GRIA1)
   05033 Nicotine addiction
    107537716 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107537716 (GRIA1)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107537716 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 107537716
NCBI-ProteinID: XP_016069278
Position
Unknown
AA seq 906 aa AA seqDB search
MQHIFAFFCTGFLGAAVGANFPSNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDTRDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASGGSSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatcttcgccttcttctgcaccgggttcctaggcgcggcagtaggtgccaat
ttccccagcaacatccagatcgggggattatttccaaaccagcagtcacaggaacatgcc
gcttttagatttgctttgtcgcaactcacagagcccccgaagctcctcccccagattgat
attgtgaacatcagcgacagctttgagatgacctatagattctgttcccagttctccaaa
ggtgtctatgccatctttgggttttatgaacggaggaccgtcaacatgctgacctccttc
tgcggggccctccatgtctgcttcatcacgccgagctttcctgttgacacatccaaccag
tttgtccttcagctgcgccccgagctgcaggatgccctcatcagtattatcgaccattac
aagtggcagaaatttgtctacatttacgatgctgaccggggtttgtccgtcctgcagaaa
gtcctggacacagctgctgagaagaactggcaggtgacagcagtcaacattttgacaacc
acggaagagggataccggatgctctttcaggacctggagaagaaaaaagagcggctggtg
gtggtggactgtgaatcggaacgcctcaacgctatcttgggccagattatcaagctggag
aagaatggtattggctaccactacatccttgcaaacctgggtttcatggacatcgactta
aacaaattcaaggagagtggagcaaatgtgacaggtttccagttggtgaactacacagac
accatcccagccaagataatgcagcagtggaagaacagcgacactcgagaccacacccgg
gtggactggaagagacctaagtacacctctgcgctcacctacgatggagtgaaggtgatg
gctgaggctttccagagcctgcgaaggcagagaatcgatatatcccgccggggcaatgct
ggggactgtctggctaacccagctgtgccctggggccaggggatcgacatccagagagct
ctgcagcaggtgcggtttgagggcctgacaggaaatgtgcagtttaatgagaaagggcgc
cggaccaactacaccctccatgtgattgagatgaagcatgacggcatccgaaagattggt
tactggaatgaagatgacaagtttgtccctgcagccactgatgctcaagctgggggggat
aattcaagtgtccagaatagaacgtacatcgtcactacaatcctagaagatccttatgtg
atgctcaagaagaacgccaaccagtttgagggcaatgaccgctatgagggctactgtgtg
gagctggcggcagagattgccaagcatgtgggctactcctaccgtcttgagatagtcagc
gatggaaaatacggagcccgcgaccctgacacaaaggcttggaatggcatggtgggagag
ctggtctatggaagagcagatgtggctgtagcccctttaacaatcaccttggtccgggag
gaggtgatagacttctccaagccatttatgagtttggggatctccatcatgataaaaaag
ccgcagaagtccaagccgggggtcttctccttccttgatcctttggcctatgagatttgg
atgtgcattgtgtttgcctacatcggagtgagcgttgtccttttcctggtcagccgtttc
agcccctatgagtggcacagtgaagagtttgaggaagggcgggaccagacaaccagcgac
cagtccaatgagtttgggatattcaacagcctgtggttctccctgggagccttcatgcag
caaggatgtgacatttctcccaggtccctgtccggccgcatcgttggtggtgtctggtgg
ttcttcactttgatcatcatctcctcatacacagccaacctggccgccttcttgaccgtg
gagaggatggtgtcgcccatcgagagtgctgaggacctagcgaagcagacggaaattgca
tacgggacattggaagcaggatccactaaggagttcttcaggaggtctaaaattgccgtg
tttgagaagatgtggacatacatgaagtcagcagaaccatcagtgtttgtacggaccacg
gaggaggggatgatccgagtgaggaaatccaaaggcaaatatgcctaccttctggagtcc
actatgaatgagtacattgagcagcggaagccctgtgacaccatgaaggtgggaggtaac
ttggattccaaaggctatggcattgcgacacccaaggggtccgccctgagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggaatgtggaagcaaggactccggaagtaaggacaagacaagcgct
ctgagcctcagcaatgtggcgggcgtgttctacatcctgatcggaggacttggactagcc
atgctggttgccttaatcgagttctgctacaaatcccgtagcgagtccaagcggatgaag
ggtttctgtttgatcccacagcaatccatcaatgaagccatacggacatcgacactcccc
cgaaacagcggggcaggagccagtggtggcagcagtggagagaatggccgagtggtcagc
cacgacttcccgaagtccatgcaatcaattccctgcatgagccacagttcagggatgccc
ttgggagccacaggattataa

DBGET integrated database retrieval system