KEGG   Miniopterus natalensis: 107538305Help
Entry
107538305         CDS       T05883                                 

Gene name
GNA13
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04071  Sphingolipid signaling pathway
mna04072  Phospholipase D signaling pathway
mna04270  Vascular smooth muscle contraction
mna04371  Apelin signaling pathway
mna04611  Platelet activation
mna04730  Long-term depression
mna04810  Regulation of actin cytoskeleton
mna04928  Parathyroid hormone synthesis, secretion and action
mna05163  Human cytomegalovirus infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107538305 (GNA13)
   04072 Phospholipase D signaling pathway
    107538305 (GNA13)
   04071 Sphingolipid signaling pathway
    107538305 (GNA13)
   04022 cGMP-PKG signaling pathway
    107538305 (GNA13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107538305 (GNA13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107538305 (GNA13)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    107538305 (GNA13)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107538305 (GNA13)
  09156 Nervous system
   04730 Long-term depression
    107538305 (GNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107538305 (GNA13)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107538305 (GNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107538305 (GNA13)
   04031 GTP-binding proteins [BR:mna04031]
    107538305 (GNA13)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107538305 (GNA13)
  Exosomal proteins of colorectal cancer cells
   107538305 (GNA13)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    107538305 (GNA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf
Motif
Other DBs
NCBI-GeneID: 107538305
NCBI-ProteinID: XP_016070004
Position
Unknown
AA seq 282 aa AA seqDB search
MRVLVDAREKLHIPWGDNSNQLNGDKMMSFDTRSPLVAQGLVETRVFLQYLPAIRALWAD
SGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYVPSQQDILLARRPTKGIHEYDFEIKN
VPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETI
VNNRVFSNVSIILFLNKTDLLEEKVQIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRR
DQQQKPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagggtgctggttgatgctcgagagaagcttcatattccttggggagataactcaaac
caactcaatggagacaagatgatgtcatttgacacccgttcacccttggtggcccaagga
ctggtggaaactcgagtttttttacagtatcttcctgctataagagcattatgggcagac
agcggcatacagaatgcctatgaccgacgtcgagaatttcaactgggtgaatctgtaaaa
tatttcctggataacttggataaacttggagaaccagattacgttccatcacaacaagat
attctgcttgccagaaggcccaccaaaggcattcatgagtacgactttgaaattaaaaat
gttcctttcaaaatggttgatgtaggtggtcagagatcagaaagaaaacgttggtttgaa
tgcttcgatagtgtgacgtcaatacttttccttgtttcctcaagtgaatttgaccaggtg
cttatggaagaccgactcaccaatcgccttacagaatctctgaacatttttgaaacaatt
gtcaataaccgggttttcagcaatgtctccataattctcttcttaaacaagacagatttg
ctcgaggagaaagtgcagattgtgagcatcaaagactatttcttagaatttgaaggggat
ccccactgcttaagagacgtccaaaaattcctggtggaatgtttccgtaacaaacgccgg
gaccagcagcagaagcccctctaccaccacttcaccacggctattaacacggagaacatc
cgcctggtgttccgcgacgtgaaagatactattctccatgacaacctcaagcagcttatg
ctccagtga

DBGET integrated database retrieval system