KEGG   Miniopterus natalensis: 107538950Help
Entry
107538950         CDS       T05883                                 

Definition
(RefSeq) heat shock 70 kDa protein 1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mna  Miniopterus natalensis
Pathway
mna03040  Spliceosome
mna04010  MAPK signaling pathway
mna04141  Protein processing in endoplasmic reticulum
mna04144  Endocytosis
mna04213  Longevity regulating pathway - multiple species
mna04612  Antigen processing and presentation
mna04915  Estrogen signaling pathway
mna05134  Legionellosis
mna05145  Toxoplasmosis
mna05162  Measles
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107538950
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107538950
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107538950
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107538950
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107538950
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107538950
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    107538950
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    107538950
  09172 Infectious disease: viral
   05162 Measles
    107538950
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107538950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107538950
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mna03041]
    107538950
   03009 Ribosome biogenesis [BR:mna03009]
    107538950
   03110 Chaperones and folding catalysts [BR:mna03110]
    107538950
   04131 Membrane trafficking [BR:mna04131]
    107538950
   03051 Proteasome [BR:mna03051]
    107538950
   03029 Mitochondrial biogenesis [BR:mna03029]
    107538950
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107538950
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107538950
Spliceosome [BR:mna03041]
 Complex B
  Other components
   Prp19 complex
    107538950
 Complex C
   Prp19-CDC5 complex
    107538950
Ribosome biogenesis [BR:mna03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107538950
Chaperones and folding catalysts [BR:mna03110]
 Heat shock proteins
  HSP70 / DNAK
   107538950
Membrane trafficking [BR:mna04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107538950
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107538950
Proteasome [BR:mna03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107538950
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107538950
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107538950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C FAD-SLDH DDR Radial_spoke_3 Pox_D5 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 107538950
NCBI-ProteinID: XP_016070789
Position
Unknown
AA seq 633 aa AA seqDB search
MAKTTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDSVVQSDMKHWPFQVISDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYAVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRGTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLRGKLSEADKKKVLDKCQEVISWLDSNTLAEKEEFEHKRKELE
QVCNPIISGLYQGAGGPGAGKALKMLTYWLQQQ
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaccacggccatcggcatcgacctgggcaccacctactcgtgcgtgggggtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagc
tacgtggccttcaccgacaccgagcggctcatcggcgacgcggccaagaaccaggtggcg
ctgaacccgcagaacaccgtgttcgacgccaagcggctgatcggccgcaagttcggcgac
tcggtggtgcagtcggacatgaagcactggcctttccaggtgatcagtgacggggacaag
cccaaggtgcaggtgagctacaaaggggagaccaaggcgttctaccccgaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggctacgcggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccaccaaggac
gcgggggtgatcgcggggctgaacgtgctgaggatcatcaacgagcccacggcggccgcc
atcgcctacggcctggacaggacgggcaagggggagcgcaacgtgctcatcttcgacctg
ggcgggggcaccttcgacgtgtccatcctgaccatcgacgacggcatcttcgaggtgaag
gccacggcgggggacacccacctgggaggggaggactttgacaacaggctggtgagccac
ttcgtggaggagttcaagcgcaagcacaagaaggacatcagccagaacaagcgagccgtg
aggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacccaggcc
agcctggagatcgactccctgttcgagggcatcgacttctacacgtccatcaccagggcg
cggttcgaggagctgtgctccgacctgttccggggcaccctggagcccgtggagaaggcc
ctgcgcgacgccaagctggacaaggcccagatccacgacctggtcctggtggggggctcc
acccgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctcaac
aagagcatcaaccccgacgaggcggtggcctacggggcggcggtgcaggcagccatcctg
atgggggacaagtctgagaacgtgcaggacctgctgctgctggacgtggctcccctgtcc
ttggggctggagacggccgggggcgtgatgacggctctgatcaagcgcaactccaccatc
cccaccaagcagacgcagatcttcaccacctattcggacaaccagccgggggtgctgatc
caggtgtacgagggcgagagggccatgacgagggacaacaacctgctggggcgcttcgag
ctgagcggcatccccccggccccccgaggcgtgccgcagatcgaggtgacctttgacatc
gacgccaatggcatcctgaacgtcacagccacggacaagagcaccggcaaggccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggccgagaggtacaaggcggaggacgaggtgcagcgcgagagggtgtcggccaagaac
gcgctggagtcgtacgccttcaacatgaagagcgccgtggaggacgaggggctgcggggc
aagctcagcgaggccgacaagaagaaggtgctggacaagtgccaggaggtcatttcctgg
ctggactccaacaccctggcggagaaggaggagtttgagcacaagaggaaggagctggag
caggtgtgtaaccccatcatcagcggactgtaccagggggcgggcggcccgggggctgga
aaggccttgaaaatgttgacctactggctgcagcagcaatga

DBGET integrated database retrieval system