KEGG   Miniopterus natalensis: 107539280
Entry
107539280         CDS       T05883                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna05200  Pathways in cancer
mna05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107539280 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107539280 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    107539280 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107539280 (MECOM)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    107539280 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 zf-C2H2_11 PyrI_C
Other DBs
NCBI-GeneID: 107539280
NCBI-ProteinID: XP_016071191
Position
Unknown
AA seq 1203 aa
MPDADGVASTPSLNIQEPCSPATSSEAFTPKEGSPYKAPIYIPDDIPIPAEFELRESNMP
GAGLGIWTRRKIEAGEKFGPYVGEQRSNLKDPSYGWEILDEFCNVKFCIDASEPDVGSWL
KYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMKSEDYPHETMAPDIHEERQ
YRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDFQQKLESENDLREIHAIQECKEC
DQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKQV
FTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQ
FSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISLPG
TPAMDKTSMVNMSHANPGLADYFGANRHPAGLTFPTAPGFSFSFPGLFPSGLYHRPPLIP
ASSPVKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKHPPVGDSKPVELQPQRSSEE
RPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIESDKEKFKENGKMFKDKVSPLQ
NLASIHNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIASIAEKYFGSTGLVGLQDKKVG
ALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSPSEVKKLQKGSSESPFDLTTK
RKDEKPLTPGSAKPSATPAASQDQPLDLSMGSRSRASGAKLSEPRKNHVFGEKKGSGAEP
RATSDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQMSAIENMA
EKLESFSALKPEASELLQSVPSMFNFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANL
TRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRH
LKKHENGNMSGTATSSPHSELESTGAILDDKEDAYFTEIRNFIGNSNHSSQSPRNTEERM
NGSHFKDEKTLVTSQNSDLLDDEEAEDEVLLDEEDEDNDLPGKTGKEPVTSNLHEGNPEE
DYEETSTLEMTCKTSPMRYKEEEYKIGLSALDHIRHFTDSLKVRKMEDNQYTEAELSSFS
TSHVPEELKQPLHRKSKSQAYAMMLSLSEKESLHSTSHSSSNVWHSMARAAAESSAIQSI
SHV
NT seq 3612 nt   +upstreamnt  +downstreamnt
atgccagatgcagatggagtagccagcacgccctccctcaatattcaagagccatgctct
ccagccacatccagcgaagcattcactccgaaggagggctctccttacaaagcccccatc
tacatcccagatgacatccccattcctgctgagtttgaactgcgagagtcaaacatgcct
ggagcgggcctaggaatatggaccagaaggaagattgaagcaggtgaaaagtttgggcct
tatgttggagagcagaggtcaaacctgaaagaccccagttatggatgggagatcttagat
gagttttgcaatgtgaagttctgcatagatgctagtgaaccagatgtaggaagctggctc
aagtacatcaggttcgctggctgttatgatcagcacaacctcgttgcatgccagataaat
gatcagatattttacagagtagtcgcggacattgcaccgggagaggagctcctgctgttc
atgaagagtgaagactatccccatgaaactatggcgcccgacatccacgaagaacggcag
tatcgctgcgaggactgcgaccagctctttgagtctaaggcggaactagcagatcaccag
aagttcccgtgcagcactccccattcagcgttttcaatggtggaagaagactttcaacaa
aaacttgaaagtgaaaatgatctgcgagagatacatgcaatccaggagtgtaaggaatgt
gaccaagtttttcctgatttgcaaagcctggagaaacacatgttgtcacatactgaagag
agggaatacaagtgtgatcagtgtcctaaagcatttaactggaagtccaatttaattcgc
caccagatgtcacatgacagtggaaagcactatgaatgtgaaaattgtgccaagcaggtt
ttcacggaccctagcaacctccagcggcacatccgctcgcagcacgtcggcgcccgggcg
cacgcttgcccggagtgtggcaaaacgttcgccacgtcgtcgggcctcaaacagcacaag
cacatccacagcagtgtgaagccctttatctgtgaggtctgccataaatcctatactcag
ttttcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgc
aaagactgtggacaaatgttcagcactacgtcttccttaaataaacacaggaggttttgt
gagggcaagaaccattttgcggcaggtggattttttggccaaggcatttcacttcctgga
accccagctatggataaaacgtccatggttaatatgagtcatgccaacccgggccttgct
gactattttggcgccaataggcatcctgctggtcttacctttccaacagctcctggattt
tcttttagcttccctggtctgtttccttccggcttgtaccacaggcctcctttgatacct
gctagttctcctgttaaaggactatcaagtactgaacagacaaacaaaagtcaaagtccc
ctcatgacacatcctcagatactgccagctacacaggatattttgaaggcactatctaaa
cacccacctgtaggggacagtaagccagtggagctccagccccagaggtcctctgaagag
aggccccttgagaaaatcagtgaccagtcagagagtagtgaccttgatgatgtcagtacg
ccaagtggcagtgacctggaaacaacctcgggctctgatctggaaagtgacattgaaagt
gataaagaaaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagccctcttcag
aatctggcttcaatacataataagaaagaatacagcaatcattccattttctcaccatct
ttagaggagcagactgcggtgtcaggagctgtgaatgattctataaaggctattgcttct
attgctgaaaaatactttggttcaacaggactggtggggctgcaagacaaaaaagttggc
gctttaccttacccttccatgtttcccctcccattttttccagcattctctcagtcaatg
tacccatttcctgatagagacttgagatcgttacccttgaaaatggaaccccaatcacca
agtgaagtaaagaaactgcagaagggaagctctgagtctccctttgatctcaccactaag
cgaaaggatgagaagcccttgactccaggatccgccaagccttcagccacgccagccgca
agccaggaccagcccctggatctgagcatgggcagtaggagtagagccagtggggcaaag
ctttccgagcctcgaaaaaaccatgtgtttggggaaaagaaaggaagcggcgctgaacca
agagctacatcagacggctccttgcagcatgctagacccactcctttctttatggacccc
atctacagagtagagaaaagaaaactaactgacccacttgaagctttaaaagagaaatac
ttgagaccttctccaggattcttatttcatccacaaatgtcagcgatcgagaacatggca
gagaagctggagagcttcagtgcgctgaaacccgaggccagcgaacttctgcagtccgtt
ccctcgatgttcaacttcagagcgccccccaacgccctgccagagaacctcctgaggaaa
ggcaaggagcgctatacctgcagatactgtggcaagatttttccaaggtctgcgaaccta
acacggcacttgagaactcacacaggagagcagccttacagatgcaaatactgtgacaga
tcatttagcatatcttctaacttgcagcggcatgttcgcaacattcacaataaggagaag
ccctttaaatgtcacttgtgtgataggtgttttggtcaacaaaccaacttagacaggcac
ctaaagaaacacgagaatgggaacatgtctggtacggcaacatcgtcgcctcattctgaa
ctggaaagtacaggtgcaattctcgatgacaaagaagatgcttacttcacagaaattaga
aatttcattgggaatagcaaccacagcagccagtctcccaggaacacagaagagaggatg
aatggcagtcactttaaggatgagaagactttggtgaccagtcagaattccgacttactg
gatgatgaagaagcagaagatgaggtgttgttagatgaggaagatgaggacaatgatctc
cccgggaaaacaggaaaggagccagtgacaagtaacttacatgaaggaaaccctgaggag
gactatgaagaaaccagcaccctggagatgacttgcaagacgtccccaatgaggtataaa
gaggaagaatacaaaattggactttctgctctagatcatataaggcacttcacagatagc
ctcaaagtgaggaaaatggaagataaccaatacactgaagctgagctctcttcttttagt
acctcccatgtgccagaggaacttaaacagccgttacacagaaagtccaaatcacaggca
tatgctatgatgttgtcattgtctgagaaggagtctctccattccacatcccacagttct
tccaacgtgtggcacagcatggcaagggctgccgccgaatccagtgccatccagtccata
agccacgtatga

DBGET integrated database retrieval system