KEGG   Miniopterus natalensis: 107539448
Entry
107539448         CDS       T05883                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107539448 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107539448 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 107539448
NCBI-ProteinID: XP_016071429
Position
Unknown
AA seq 85 aa
MERLSPATGLRAPSPCSCEPALLLTGFLLAGPLLQPSARKGLEEGNVRHLVQPRGSRNGP
GPWQGGRKKFRRQRPRLSHKGPMPF
NT seq 258 nt   +upstreamnt  +downstreamnt
atggagaggttgtcccctgccacgggcctgcgggctccgtccccctgctcatgtgaacca
gccctcctgctaacaggctttctccttgcagggcccctgctgcagccttctgccaggaag
gggctggaggaaggcaatgtccgccacctggtgcagcccagagggtcaaggaatggacca
gggccctggcagggaggtcggaaaaaattccgccgccagcggccacgcctctctcataag
ggccccatgcctttctga

DBGET integrated database retrieval system