KEGG   Miniopterus natalensis: 107539602
Entry
107539602         CDS       T05883                                 

Gene name
LNPEP
Definition
(RefSeq) leucyl-cystinyl aminopeptidase isoform X1
  KO
K01257  cystinyl aminopeptidase [EC:3.4.11.3]
Organism
mna  Miniopterus natalensis
Pathway
mna04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    107539602 (LNPEP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107539602 (LNPEP)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.3  cystinyl aminopeptidase
     107539602 (LNPEP)
Peptidases and inhibitors [BR:mna01002]
 Metallo peptidases
  Family M1
   107539602 (LNPEP)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N pP_pnuc_1 Paramyxo_C Dynactin
Other DBs
NCBI-GeneID: 107539602
NCBI-ProteinID: XP_016071634
Position
Unknown
AA seq 1044 aa
MEPFTSGEWAARGAGAGALRGPEDRDRLPLPRNMIENSMFEEEPDVVDLAKEPCLHPLEP
DEVEYEPRGSRLLVRGLGEHDLEEDEEDCESSAKLLGMSFMNRSSGLRASGAGYRQSPDG
ACSFPSLRTVAVCAFVILLAISVIMVIYLLPRCTFTKEGCHKKNQSMGLIQPIATNGKLF
PWTQVRLPTAVMPLHYELNLHPNLTSMTFEGSVVISLQALQATWNIILHSTGHNISRVTF
MSAVSSQEKQVEVLEYPFHEQIAIVAPETLLEGQNYTLKIEYSANISSSYYGFYGITYTD
ESHKKKYFAATQFEPLAARSAFPCFDEPAFKAAFTIKIIREEQYTTLSNMPKKSSVIVKD
GLVQDEFFESVKMSTYLVAFIVGEMKNLSREINGTLVSIYSVPEKIDQVYHALETTVKLL
EFYQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDNNTSSDADRKLVTKV
IAHELAHQWFGNLVTMQWWNDLWLNEGLATFMEYFSLEKIFKELSSYEDFLDARFKTMKK
DSLNSSHPISSSVQSSEQIEEMFDALSYFKGASLLLMLKTYLGNDVFQRALVLYLHDHSY
ASIQSDDLWDSFNEVTNKTLDIKKMMKTWTLQKGFPLVTVQRKGKELHVQQERFFLNMKP
EIQPSDASYLWHIPLSFVTEGRNSSKHQLVSFLDKKSDVINLTEEVQWIKVNTDMTGYYI
VHYADDDWDALIKQLKINPYVLSDKDRANLINNIFELAGLGKVPLQRAFDLIDYLGNETY
TAPITEALFQTGLIYNLLEKLGYMDLASRLVTRVFKLLQSQIQHQNWTDEGTPSARELRS
ALLEFACTHSLENCSSTAMKLFDDWVASNGTLSLPTDVMTAVFKVGARTERGWLSLLSKY
TSVGSEAEKNKILEALASSEDVRKLYWLMKTSLSGDIIRTQKLSFVIRTVGQHFPGHLLA
WDFVKENWNKLVQKFHLGSYTIQSIVAGSTHLFSTKAHLSEVQAFFENQSEATFRLRCVQ
EALEVIQLNIQWMEKNLKTLAGWL
NT seq 3135 nt   +upstreamnt  +downstreamnt
atggagcccttcaccagtggtgagtgggcggccagaggggccggggccggagctcttcgc
ggcccggaggatcgcgaccggcttccgctccccaggaatatgattgaaaacagcatgttt
gaggaagaaccagatgtggtagatttggccaaagagccttgtttacatcctttagagcct
gacgaggtggaatatgagccccggggctctcggctgctggtgcggggcctgggcgagcac
gacttggaggaggacgaggaggactgcgagtcgtcggcgaagctgctgggcatgtccttc
atgaacaggagctcgggcctgcgggccagcggcgccggctacaggcagagccccgacggg
gcctgttcgtttccctccctaaggaccgtggccgtctgtgcttttgtcattctgcttgcc
atttctgtaataatggtaatttatctactgcccagatgtacttttaccaaagaaggctgc
cataagaaaaaccaatcaatgggactaattcagccgattgcaacaaatgggaagctgttt
ccatggacacaagtcaggcttcccactgccgttatgccactgcactatgaacttaaccta
cacccaaacctaacctcaatgacattcgagggttctgtggtgatttcgcttcaggctctt
caggccacgtggaatatcattcttcacagcacgggccataatatttcaagagtgaccttt
atgtcagcagtttcaagccaagagaaacaagttgaggtcctggaatatccatttcatgaa
caaatcgccattgtcgcccctgaaacccttcttgaggggcagaattataccttgaagata
gagtactcggcaaatatatctagttcttattatgggttttatggtatcacctacacagat
gaaagtcataagaaaaagtactttgcagcaactcagtttgaacccctggctgcaagatct
gcttttccttgttttgatgaaccagcatttaaagccgcatttaccatcaagatcataaga
gaggagcaatacactactttatcaaatatgcctaagaagtcatcagtcattgtgaaagat
ggacttgttcaggatgaatttttcgaaagtgtgaagatgagcacttacctggttgctttc
attgtgggggagatgaagaatctgagtcgggaaataaatggaaccctggtttccatatat
tctgtaccagaaaagattgatcaagtttatcatgccttggaaacaactgtgaagcttctt
gaattttaccaaaactactttgaaattcaatacccacttaagaaattggatttggtggct
attcctgactttgaagcaggagcaatggaaaattggggtttgctcaccttccgagaagag
acacttctctatgacaataatacttcttcagacgcggatagaaaactggttactaaagtc
attgctcatgaactggcccatcagtggtttggtaatctggtaacgatgcagtggtggaac
gatttatggctaaatgaaggtttggctactttcatggagtatttctctttggaaaaaata
tttaaagaactgtccagttatgaagatttcttagatgctcgatttaaaaccatgaagaaa
gattccttgaattcatctcatccaatatcatcatctgttcagtcttcagaacagattgaa
gaaatgtttgatgctctttcctattttaagggagcttctctcttgttgatgctgaagact
taccttggtaacgatgtatttcagcgtgctcttgttctttacctgcatgatcatagctat
gcatccattcaaagtgatgatctgtgggatagttttaatgaggtcacaaacaaaacacta
gatataaagaaaatgatgaaaacctggaccctgcagaaagggtttcctttagtgactgtt
caaagaaaaggaaaggagcttcatgtacaacaagaaagattctttttaaatatgaagcct
gaaattcagccttcagatgcaagctatctatggcatattccactatcctttgttactgag
ggaagaaattcttcaaaacatcaattggtatcatttctggacaagaaatcagatgtcatc
aatcttacagaagaagtgcagtggatcaaagtcaatacagacatgactggctattatatc
gtacattatgcagatgatgactgggacgcactaatcaaacagttgaaaataaatccttat
gtgctgagtgacaaagaccgagccaacctcatcaataacatctttgaacttgcaggccta
ggcaaagtgcctcttcagagggcctttgatttgattgattatcttggaaatgagacctac
acggcacctatcactgaagccctgttccagacaggcctcatctataacctccttgaaaag
ctaggatacatggatttggcctcaagactggtgaccagagtatttaaattgcttcaaagc
caaattcaacaccaaaattggactgatgagggcaccccatctgctcgagagctgcggtca
gccttgctagaatttgcttgcacccacagcctggagaactgcagttctactgccatgaag
ctatttgacgattgggtggcatccaatggaactcttagcctacctactgatgtcatgact
gctgtgttcaaagttggagcgagaactgagaggggctggttgtccctcctaagcaagtac
acctctgtaggctctgaagcagagaagaataaaatacttgaagctcttgccagctcagag
gatgtacggaagctttactggttaatgaaaactagcctcagtggagatatcatccgaaca
caaaagctgtcatttgtcattagaacagtgggccagcattttcctggacacttattggcg
tgggattttgtcaaagagaactggaataagcttgtacagaagttccatctgggttcctat
accatacagagtattgttgctggatcaactcacctgttttcaacaaaggcacacttgtcg
gaggttcaggcattctttgaaaatcagtcagaggcaaccttccggcttcgttgtgtccag
gaggctttggaagtcattcagttgaatatccagtggatggagaagaacctgaaaactctg
gcagggtggctgtag

DBGET integrated database retrieval system