KEGG   Miniopterus natalensis: 107539624
Entry
107539624         CDS       T05883                                 

Gene name
ERAP2
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 2
  KO
K13723  endoplasmic reticulum aminopeptidase 2 [EC:3.4.11.-]
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107539624 (ERAP2)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     107539624 (ERAP2)
Peptidases and inhibitors [BR:mna01002]
 Metallo peptidases
  Family M1
   107539624 (ERAP2)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 107539624
NCBI-ProteinID: XP_016071675
Position
Unknown
AA seq 954 aa
MVHLHRKLIFSVYIGFYLATIILPKICVCSQFSIPSSDQFSKAPGAFPVATNGEPFPWHE
LRLPNTVIPLHYDLFVHPNLTSMDFVASEKIEVLVRDATQFIILHSKNLEIMNVTLHSEE
DLKYRKPGKKLNVLSYPAHQQIALLVPEKLIADLKYYVAIDFQAKLADGFEGFYKSTYRN
LGGETRTIAVTDFEPTEARMAFPCFDEPSFKANFSIKIRRESRHIALSNMPKVKTIELEG
SLLEDHFETTVKMSTYLVAYIVCDFKSVSGTTSSGVKVSIYASPDKWSQTHYALEASLKL
LDFYENYFDINYPLPKLDLIAIPDFGPGAMENWGLITYRETSLLFDPKTSSISDKLWVTT
VIAHELAHQWFGNLVTMEWWNDIWLNEGFATFMELISLDATYPELHFDYCFLEVCFEAIK
RDSLNSSRPISNQAKTPTQIQEMFDTVSYNKGACILNMLKDFLSEEKFHKGIIHYLKKFS
YGNTKNDDLWSSLSNSCSEGDFTSGGFCYSDSKRTTSTLTSQGENAEVKEMTATWTLQKG
IPLVVVEQEGRSLRLRQERFLSGVFKEDPEWRALQEGYLWHIPLTYSTRSSNTIHRHILK
SKTDTLDLPEKSSWVKFNVNSNGYYIVHYEGHGWDQLIAQLNQNHTLLRPKDRVGLIHDA
FQLVSAGRLTLDKALDLTRYLQHETSIPALLKGLGYLELFYHMMDRRNISDVTENLKHYL
LQYFKPVIDTQSWSDEGSIWDRMLRSTLLKLACDLNHAPCIQKATELFSQWMESSGKLNI
PTDVLKIVYSVGAQTTAGWNYLLEQYELSVSGAEKNKILYALSTSKHQEKLMKLIELGME
GKIIKTQDLAALLHAIARNPKGQQLAWNFVRENWTHLLKKFDLGSYAVRMIISGTTSHFS
FKDELQEVKLFFESLKAQGSHLDIFQTVLETISKNIKWLEKNLPTLRTWLLVRT
NT seq 2865 nt   +upstreamnt  +downstreamnt
atggttcatttacacagaaaactaatatttagtgtttacataggattttacctcgcaaca
atcatcctacctaaaatatgtgtttgttctcagttctcaataccatctagtgatcagttc
agtaaggcccctggggctttcccagtagccaccaatggggaaccatttccttggcatgag
ctaaggctccccaacacggtcattcccctccactatgacctttttgtccatccaaatctc
acttccatggactttgttgcatctgagaagattgaagtcttagtcagagatgccacccaa
tttatcatcctacacagcaaaaaccttgaaatcatgaatgtcacccttcattctgaggaa
gatttgaaatacaggaaaccagggaagaagctgaatgttttgagttatcctgctcatcaa
caaattgctctgctggttccagagaaacttattgctgacctgaaatattatgtagccatt
gattttcaggccaagttagctgatggttttgaagggttttataaaagcacgtacagaaat
cttggtggtgaaacaagaacaattgcagtaacagattttgagccaactgaggcacgaatg
gctttcccttgctttgatgaaccatcgttcaaagccaacttttcaatcaagataagaaga
gagagcagacacattgcactatccaacatgccgaaggttaagacaattgaacttgaaggc
agcctcttggaagatcattttgaaactactgtaaaaatgagtacataccttgtagcctac
atagtttgtgatttcaagtctgtgagtgggacaacctcatcaggggtcaaggtgtccatc
tatgcatccccagacaaatggagtcaaactcattatgctttggaggcatcattgaagcta
cttgatttttatgaaaattactttgatatcaactatccactccccaaactggatctaatt
gctattcctgactttggacctggagccatggaaaattggggcctcatcacatatagagag
acatcactgctctttgatcccaagacctcttccatttctgataaactctgggtcaccacc
gtcatcgcccatgaactagcacaccagtggtttggcaacctggttacaatggaatggtgg
aatgacatttggctcaatgagggttttgcaacattcatggaacttatctctcttgatgct
acgtatccagagctacactttgattactgttttttggaagtgtgttttgaagcaattaaa
agagattcattaaattcatcccgtcctatctccaatcaagcaaaaactcctactcaaata
caagaaatgtttgatacagtttcctacaacaagggagcttgtattttgaatatgctcaag
gatttcctgagtgaggagaaatttcacaaaggaattattcactacttaaagaagttcagc
tatggaaatactaagaatgatgatttgtggagcagtctgtcaaatagctgttcagaaggt
gattttacgtctggtgggttttgttattccgattccaaaaggacaaccagcacactcacc
tctcagggggaaaatgcagaggtcaaagagatgacagctacgtggactctgcagaaagga
atccccctcgtggtggtggaacaagaagggcgttcgctcagactgcggcaggagcgcttc
ctcagcggggtgttcaaagaggaccctgaatggagggccctgcaggaagggtacctttgg
cacatcccattgacctactccacaagatcctctaatacgattcacagacacattctaaaa
tcaaagacagatactctggacttacctgaaaagtctagctgggtgaaattcaatgtgaac
tcaaatggttactacatcgttcactatgaggggcatggatgggaccaactcattgcacag
ctgaatcagaaccacacacttctcagacctaaggacagagtaggtctgatccatgatgcg
tttcagcttgtaagtgcaggaaggttgaccctagacaaagccctcgacctgactcgctat
ctccaacatgaaacaagcatccctgcacttctcaaaggtctgggatacttagaattgttt
taccacatgatggatagaaggaatatttcagatgtcactgaaaacctcaagcattacctt
cttcagtattttaagccagtgattgacacacaaagctggagcgatgagggctctatctgg
gacaggatgctccgctccaccctcctgaagctggcctgtgacctgaaccatgctccttgc
atccagaaggcaactgaactcttctctcagtggatggaatccagtggaaaattaaacatc
ccaacagatgttttaaaaattgtgtattctgtcggtgctcagacaacagcaggatggaat
taccttttggagcaatatgaactgtcagtgtcaggtgctgaaaaaaacaaaattctgtat
gcattatcaaccagcaaacatcaggaaaagttaatgaaattaattgaactaggaatggaa
ggaaagattatcaagacacaggacttggcagctcttcttcatgcaattgctagaaatccg
aaggggcagcaattagcctggaattttgtaagagaaaattggacccatctcctaaaaaaa
tttgacttgggctcatatgctgtgagaatgatcatctctggcacaacgtcccacttttct
ttcaaggatgagttgcaagaggtgaaactgttctttgaatctcttaaagcccaaggatca
catctggatatttttcaaacagttctggaaaccatatccaaaaatattaagtggctggag
aagaatcttcccactctaaggacttggctactggttaggacttaa

DBGET integrated database retrieval system