KEGG   Miniopterus natalensis: 107543170Help
Entry
107543170         CDS       T05883                                 

Gene name
HLCS
Definition
(RefSeq) biotin--protein ligase
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
mna  Miniopterus natalensis
Pathway
mna00780  Biotin metabolism
mna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    107543170 (HLCS)
Enzymes [BR:mna01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     107543170 (HLCS)
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     107543170 (HLCS)
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     107543170 (HLCS)
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     107543170 (HLCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_N BPL_C
Motif
Other DBs
NCBI-GeneID: 107543170
NCBI-ProteinID: XP_016076105
Position
Unknown
AA seq 726 aa AA seqDB search
MEDRLQMANGLIPQKIVSVHLQDSALKELKDQAANKPSHILQPNPESAVEGELGPGVMEH
VGKDDPKVLGAEPTQGQGGASGSEPAGESDGEGCVELCHLHLSSCHECLELENSTIESVK
FASAEDIPDLPYDPSGSSEGVAEVTCREREGRRANMTGKAPNILIYVGSDSQETLGRFQQ
VRSVLADCVDPDGYTLYHLPGDSALRDPWSDNCLLLVIATGESIPKDLYQKFMAYLSQGG
KVLGLSSSFTFAGFRVTSKDALQATVQNLVFSKADGSQVKLSVLSSGCVYQEGSGECLSL
GGLQGHLENDDEDRLIVQVPFGAHGGEAVLCQVHLELPPSSSVVQTKEDFNLLKSSNSRR
YEVLKEILITLGLSCDIKHVPALTPLHLLLASEEIRDPFMQWLEKRVDPGGVITSSKLSL
KFVPSYTSEIEVTPTAVPVVTDTMAFSSENFNLEIYRQNLQTKRLGKVILFAEVTSTTMN
LLDGLMFEMPQEMGLIAIAVRQTQGKGRGRNVWLSPAGCALSTLLVSIPLRSPLGQRIPF
VQHLMSLAVVEAVRSIPGYQDINLRVKWPNDIYYSDLVKLGGVLVNSTLMGETFYILIGC
GFNVTNSNPTICINDLITEYNKEHGVELEPLRSDHLIARTVTVLENLIDTFQNEGPNGVL
PLYYKYWAHSAQQVCLGSAEGPKVSVVGLDDSGFLQVHQEDGQVVTVHPDGNSFDMLRNL
IIPKQQ
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggaagatagactccagatggctaatggactgataccccaaaagattgtttcggtgcac
ctgcaggactccgctctgaaggaacttaaggaccaggctgctaacaagccatcccacatc
ctgcagccgaaccctgaatctgctgtcgagggtgagctgggtccgggcgttatggagcac
gttggtaaagatgacccaaaggttcttggtgcagaacccacccaagggcaaggcggtgcc
tctgggagcgagcctgctggggagagcgacggagagggctgcgtcgagctctgtcacctc
catctgtctagttgccacgagtgtttggagctggagaacagcaccattgaatccgtcaag
tttgcatctgcagaggacattccagatcttccctacgaccccagcggcagttcggagggt
gttgctgaagttacctgccgggagagagaagggaggagagccaatatgacgggaaaggca
cccaacatcctcatctatgtgggctccgactcccaggaaaccctgggcaggttccagcag
gtccggtctgtcctggctgactgtgtggaccccgatggctacacgctttaccacctgccg
ggggacagtgcgctcagagacccgtggtcagacaactgcctgttgttggtcattgccacc
ggggagtctattcccaaagacctgtaccagaagttcatggcctacctttctcagggaggg
aaggtgctgggtctgtcctcgtccttcacgtttgccggcttccgggtgaccagcaaggac
gcattgcaggcgacagtccagaacttggttttctccaaggctgacgggagccaggtgaag
ctcagcgtcctgagcagtggctgcgtttaccaggagggctccggggagtgtctcagcctg
ggcgggctccagggccacctggagaatgatgatgaggacaggctgattgtgcaagtgcct
tttggagcacacggaggagaggctgttctttgccaggtgcacttagaactacctcccagc
tcttcagtagtgcagactaaagaagatttcaatctgctcaagtctagcaatagtagaaga
tatgaagtccttaaggagatcctgatcacccttggcctaagctgtgacataaagcacgtt
cctgccttaactcctcttcacctgctcttggcttcggaggaaatccgggatccttttatg
cagtggctggagaaacgtgtggatccaggaggagtaataacatccagcaagctctccctc
aagtttgtcccatcctacacatctgaaatagaagtcaccccaactgctgtacccgtggtg
actgacacaatggccttctcctctgaaaattttaacttagagatctaccgacaaaatttg
cagacaaaacgacttggaaaagtaattctgtttgccgaagtgacgtccaccaccatgaat
cttctggacgggttgatgtttgagatgccacaggaaatgggtttaatagccatcgcagtc
cgccaaacacagggcaaagggcgaggaaggaatgtatggctgagccccgcaggatgcgct
ctttctacgctgctggtatccatcccactgagatccccgctgggacagaggatcccattt
gtccagcatctgatgtccctggctgtggtggaggcggtcaggtccattcctgggtaccag
gacatcaacttacgggtgaagtggcccaacgacatttattacagtgacctcgtgaaactt
ggcggagttctggttaactccacgcttatgggagaaacattttatatacttattggctgt
ggatttaacgtgactaacagtaaccctaccatatgcatcaacgacctcatcacagaatac
aataaggagcacggggtggaactggagcccttaagatctgatcatctcatcgccagaacc
gtgacggtgctggagaacctgattgacacgtttcagaacgaagggcccaatggtgttctc
cccctttattataagtactgggcacacagtgcccagcaagtctgcctgggaagtgctgag
gggccaaaggtgtcagtcgtcggcctggatgattctggtttcctccaggttcaccaggaa
gatggccaggtggtgactgtacatccagacggcaactccttcgacatgctcagaaacctc
atcatccccaaacagcagtag

DBGET integrated database retrieval system