KEGG   Miniopterus natalensis: 107543420Help
Entry
107543420         CDS       T05883                                 

Gene name
PRODH2
Definition
(RefSeq) probable proline dehydrogenase 2
  KO
K11394  hydroxyproline dehydrogenase [EC:1.5.5.3]
Organism
mna  Miniopterus natalensis
Pathway
mna00330  Arginine and proline metabolism
mna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    107543420 (PRODH2)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.3  hydroxyproline dehydrogenase
     107543420 (PRODH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_dh
Motif
Other DBs
NCBI-GeneID: 107543420
NCBI-ProteinID: XP_016076431
Position
Unknown
AA seq 461 aa AA seqDB search
MMFRTCPVLYSQAGSPTQGWQPLSFDGGAFHLKGTGELTRALLVLRLCAWPPLVTHGLAL
QAWSQRLLGSRFSGALLRASIYGQFVAGETAEEVRGCVQQLQTLSLRPLLAVPTEEEPDS
AVKTGEAWYEGNLRAMLRCVDLSRSLLETTGPTGNVLMQLKVTALTSTRLCKELTSWVRR
PEASVELSPERLAEAMDSGKDFQVSGLSTEQNQHLQASLSRLQRVVQHARAQRVRLLVDA
EYTSLNPALSLLVASLALLWNSSREGGPWVWNTYQAYLKDTHERLRRDAEAADRAGLAFG
VKLVRGAYLDKERERARLQGTEDPTQPDYEATSRSYRRCLELMLTHVSHRGPMCHLMVAS
HNEESVHQATKRMWELGIPPDGPVCFGQLLGMCDHVSLALGQASYAVYKSIPYGSLEEVI
PYLIRRAQENRSVLRGSRREWELLSQELRRRLLGRSLRGPY
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgatgttccggacctgtccagtcctctactcccaggctggctccccaacccagggctgg
cagcccctgagctttgatggtggggccttccacctcaagggcacaggggaactgacgcgg
gcattgctggtgctacggctgtgtgcctggccccctctggtcacccatggcctggcgctc
caggcctggtctcagcgactcctgggttcccggttctcaggcgcacttctccgagcatcc
atctatggacagtttgtggctggtgagacggcagaggaggtgaggggctgcgtccagcaa
ctccagaccctaagcctccggcccctgctggcagtgcccacagaggaggagccagactca
gctgtcaagactggcgaggcctggtatgaggggaacctcagagctatgctgcggtgtgtg
gacctgtcacggagcctcctggagaccactggcccaactgggaatgtcctcatgcagctg
aaggtgacggcgctgaccagcactcggctctgtaaggagctaacttcatgggtcagaagg
ccagaggcttccgtggagctgagccctgagaggctggcagaagccatggactctggaaag
gacttccaggtctctggcctcagcaccgagcaaaaccagcatctccaggcctctctgagc
cgcttgcagcgggtggtacagcatgcccgggcccaacgtgtgaggctcctggtggatgct
gagtacacctcgctgaatcctgctctctctctgctggtggcttccctggccttgctctgg
aacagctccagggagggcgggccctgggtgtggaacacctaccaggcctatctgaaggac
acccacgagcggctgaggcgggatgccgaggctgcggatagggccggcctggccttcgga
gtgaagctggtacgaggggcctatctggacaaggagagggagagggcccggcttcaaggg
actgaagatcccactcagcccgactatgaggctaccagtcggagttacagacgctgtctg
gagctgatgctgacccatgtgtcccaccgtggccccatgtgccacctcatggtggcttcc
cacaatgaggaatctgttcaccaggcaaccaaacgcatgtgggagctgggcattcctccg
gacgggcctgtctgttttggacaacttctgggaatgtgtgaccacgtctccctggcattg
gggcaggccagctatgctgtgtataagtcaatcccctacggctccctggaggaagtgatc
ccctacctgatccggagggcccaggagaaccggagtgtgctgcggggttcccgcagggaa
tgggagctgctcagtcaagaacttcggaggaggctactggggcggagcctgaggggaccc
tattag

DBGET integrated database retrieval system