KEGG   Miniopterus natalensis: 107544422Help
Entry
107544422         CDS       T05883                                 

Gene name
FKBP9
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP9
  KO
K09575  FK506-binding protein 9/10 [EC:5.2.1.8]
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mna03110]
    107544422 (FKBP9)
Enzymes [BR:mna01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     107544422 (FKBP9)
Chaperones and folding catalysts [BR:mna03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    107544422 (FKBP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 107544422
NCBI-ProteinID: XP_016077800
Position
Unknown
AA seq 533 aa AA seqDB search
MERRFVPDECPRAVRSGDFVRYHYVGTFPDGQKFDSSYDRDSTFNVFVGKGQLIAGMDQA
LVGMCVNERRFVKIPPKLAYGSEGVSGVIPPNSVLHFDVLLMDIWNSEDQVQVHTYFKPP
SCPRTIQVSDFVRYHYNGTFLDGTLFDSSHNRMKTYDTYVGIGWLIPGMDKGLLGMCVGE
KRIITIPPFLAYGEDGDGKDIPGQASLVFDVALLDLHNPKDGIAIENKVVPENCERRSQS
GDFLRYHYNGTLLDGTFFDSSYSRNRTFDTYIGQGYVIAGMDEGLLGVCIGEKRRIVVPP
HLGYGEEGRGNIPGSAVLVFDIHVIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYN
ASLLDGTLLDSTWNLGKTYNIVLGSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGV
DGEVPGSAVLVFDIELLELVAGLPEGYMFIWNDEVSPNLFEEIDKDGNGEVLLEEFSEYI
HAQVASGKGKLAPGFDAEMIVKNMFTNQDRNGDGKVTAEEFKLKDQEAKHDEL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggagcggcgcttcgtgcccgacgagtgcccgcgcgccgtgcgcagcggcgacttcgtg
cgctaccactacgtggggaccttccccgacggccagaagttcgactccagctacgacaga
gactccactttcaacgtgttcgtgggaaaaggacagctgatcgcagggatggaccaggct
ctggttgggatgtgcgtgaacgagaggcgttttgtgaagatccccccgaagctcgcttac
ggaagcgaaggcgtttctggtgtgatccccccaaactcagtgcttcattttgacgttctt
ctgatggacatttggaattctgaagatcaggttcaggttcacacttacttcaagcccccg
agttgccctcggaccatccaggtgtctgatttcgtgaggtatcactacaatgggacgttc
ttggacgggacactgtttgattccagtcataatcgcatgaagacatatgacacctacgtg
ggaatcggctggctgattcctggaatggataaagggctgctggggatgtgtgtgggggaa
aaacgcatcatcaccattcctccctttctggcctatggagaagacggagacgggaaggac
attcctggacaggcgtctctggtgttcgacgttgcgctgttggaccttcacaaccccaag
gatggcattgccattgagaacaaggtagtgcctgaaaactgcgagcgccggagtcagagc
ggggactttctccgataccattacaacggcacgcttctggacggcaccttctttgactcc
agctactcacggaaccgcacctttgacacgtacatcgggcagggctacgtgatcgccggg
atggatgaagggttactgggcgtctgcatcggagagaagcggaggatcgtggtgccccct
cacctgggctacggggaggaggggagagggaatatccctggctcggctgtgctggtgttt
gacatccacgtgatcgacttccacaacccttcagactccatcagcatcacgtcgcactac
aagccccccgactgctcagtgctgagtaagaagggcgattacctcaagtatcactacaac
gcctcgcttctggatgggaccctgctggattccacgtggaatttaggcaaaacgtataac
attgttctgggatctggacaagtcgtgctggggatggatatgggcctccgagagatgtgt
gttggagagaagcggaccgtgatcatcccaccccacctgggctacggggaggctggcgtg
gatggagaggtgcccggcagtgccgtgttggtgtttgacatcgagctgctggagctggtg
gctggcctgcctgaggggtacatgttcatatggaatgacgaggtgtcccccaacctcttt
gaagaaatcgacaaggatggcaacggagaagtccttctggaagagttctcagagtacatt
cacgcccaggtggcatcgggcaaggggaagctcgctcccgggtttgacgctgagatgatc
gtgaagaatatgttcaccaaccaggaccgcaatggagacggcaaggtcacggccgaggag
tttaaactcaaagaccaggaggccaaacacgacgaactctga

DBGET integrated database retrieval system