KEGG   Miniopterus natalensis: 107544743Help
Entry
107544743         CDS       T05883                                 

Gene name
PLK1
Definition
(RefSeq) serine/threonine-protein kinase PLK1
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
mna  Miniopterus natalensis
Pathway
mna04068  FoxO signaling pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107544743 (PLK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107544743 (PLK1)
   04114 Oocyte meiosis
    107544743 (PLK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107544743 (PLK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107544743 (PLK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107544743 (PLK1)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     107544743 (PLK1)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   107544743 (PLK1)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     107544743 (PLK1)
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107544743 (PLK1)
  Sister chromatid separation proteins
   Polo kinases
    107544743 (PLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase POLO_box Pkinase_Tyr Kinase-like Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 107544743
NCBI-ProteinID: XP_016078143
Position
Unknown
AA seq 570 aa AA seqDB search
PPGKEIPEVLVDPRSRRRYLRGRFLGKGGFAKCFEISDADSKEVFAGKIVPKSLLLKPHQ
KEKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEAR
YYLRQVVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYEGERKKTLCGT
PNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHI
NPVAASLIQKMLQTDPTARPTIHELLNDEFFTSGYIPARLPVTCLTVPPRFSIAPSSLDP
SSRKPLSVLNKGTENPMPERPREKEEPVVRETTEAVDCHLGDMLQQLHSVNASKPSERGL
VRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYI
ERDGTESYLTVNSHPNSLTKKITLLKYFRNYMSEHLLKAGANITPREGDELARLPYLRTW
FRTRSAIILHLSNGCVQINFFQDHTKLILCPLMAAVTYINEKRDFRTYRLSLLEEYGCSK
ELASRLRYARTMVDKLLSSRSATNRLKASS
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
ccgccgggcaaagagatcccggaggtgctggtggacccccgcagccggcggcgctacctg
cggggccgcttcctgggcaagggcggcttcgccaagtgcttcgagatctcggacgcggac
tccaaggaggtgttcgcgggcaagatcgtgcccaagtccctgctgctgaagccgcaccag
aaggagaagatgtccatggagatatccattcaccgcagcctcgcccaccagcacgtcgtg
ggcttccacggctttttcgaggacaacgacttcgtgttcgtggtgctggagctgtgccgc
cggagatcgctcctggaactgcacaagcgcaggaaagcgctgaccgagcccgaggcccgc
tactacctgcggcaggtggtccttggctgccagtacctgcaccgaaaccgggtcatccac
cgcgacctcaagctgggcaacctcttcctcaacgaggacctggaggtgaaaataggggat
tttggactggcaaccaaagtggaatatgaaggggaacggaagaagaccctgtgcggaact
cccaattacatagctcctgaggtgctgagcaagaaagggcacagttttgaggtggacgtg
tggtccattgggtgcatcatgtataccttgttagtgggcaagcccccatttgagacatct
tgcctaaaagagacctacctacggatcaagaagaacgagtacagcatccccaagcacatc
aacccggtggcggcctccctcattcagaagatgctccagactgaccccactgcccgcccc
accatccacgagctgctcaacgatgagtttttcacctctggctacatccccgcccgtctg
cccgtcacctgcctcaccgtcccacccaggttttccattgctcccagcagcctggacccc
agcagccggaagcctctctccgtcctcaataaaggtacggagaaccccatgcctgagagg
ccccgagaaaaagaggaaccagtggtccgagagactaccgaggcggtagactgccacctt
ggtgacatgctacagcaactgcacagtgtcaacgcctccaagccctcagagcggggcctg
gtcaggcaagaggaggctgaggatcccgcctgcatccccatcttctgggtcagcaagtgg
gtggactattcggacaagtacggccttggatatcaactgtgtgacaacagcgtgggggtg
ctcttcaatgactcgacacgcctgatcctctacaacgacggcgacagcctgcagtacata
gagcgtgatggcacagagtcctacctcaccgtgaattctcaccccaactccttgacaaag
aagatcaccctccttaaatatttccggaactacatgagcgagcacttgctgaaggcaggg
gccaacatcacgccacgggagggcgacgagctggcccggctgccctacctgcggacctgg
tttcgcacgcgcagtgccatcatcctgcacctcagtaacggctgtgtgcagatcaacttc
ttccaggaccacaccaagctcatcctgtgcccgctgatggccgccgtgacttacatcaac
gagaagcgggacttccgcacgtaccgcctgagcctcctggaggagtacggctgctccaag
gagctggccagccgcctccgatacgcccgcaccatggtggacaagctgctgagctctcgc
tcggccaccaaccgcctcaaggcctcctcgtag

DBGET integrated database retrieval system