KEGG   Miniopterus natalensis: 107545678
Entry
107545678         CDS       T05883                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107545678 (AKAP5)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     107545678 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 107545678
NCBI-ProteinID: XP_016079301
Position
Unknown
AA seq 427 aa
MEIPVSEIQVESKDEKRSAVSPQGERQEEKAPMLCFKRRKKSAKATKPKAGSEAVDVAGK
CPSGAGASDQPQPPGGAWASIKRLVTRRKQPDSSKQQKPFEANVQPEVNAEDADLSKKKA
KSRFRIPCIKFSKGEKRHNHSRIIEDTDCSIKVQGEAEKLDTKTPTQSDDQAAKAKLTQD
VSGDVSQKEGDEVCEPNVSNSRTSPGENVISVELGLDMGHSAVQTGTLILEKDIETVEEE
QSVPPQQTSPLETSETQHQLPGVSEALPSPATPDQQIVEEARNDIPESGPNSKDQESVEI
VAEKIKPKDTELSQESDFKEIKISAEKPKPEENKRMEPIAIIITDTEISEFDVTKSKNVP
KPFLMSVENEEVGGFAECGFEGRTSEQYETLLIQTASSLVKNAIQLSIEQLVNEMASDDN
KINNLLQ
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggagatcccagtttctgaaattcaagtagaaagcaaggatgagaagagatcagccgtt
agtcctcagggtgagaggcaggaggagaaggcaccgatgctttgcttcaagagaagaaag
aaatcagccaaagccacgaagcccaaggctggctccgaagctgtcgatgtggccgggaag
tgtccttcaggagcaggagcttctgatcagccgcagcccccagggggggcctgggcctca
ataaaacgccttgtaacacgcaggaaacagccagattcttcaaagcagcaaaagcccttt
gaggctaacgtgcaacctgaagtcaatgccgaggatgctgatctttctaagaaaaaggca
aaatccagatttagaattccctgcataaaattctcgaaaggggagaaaagacacaatcat
tccagaattatagaagatacagactgcagcatcaaagttcagggagaagctgaaaagttg
gatacaaaaactccaacccaatccgatgaccaggcagcaaaggccaagttgacccaggat
gtaagtggagatgtctcacagaaagaaggtgatgaggtttgtgaaccaaacgtgagcaac
agcagaacttctcctggagagaacgtgatttcagtagaacttgggttagatatggggcat
tctgctgttcaaacaggaactctaatccttgaaaaagacattgaaacggttgaggaagaa
caaagtgtcccaccccagcaaacaagcccacttgaaacttcagaaacacaacaccagcta
ccaggggtttctgaggctctcccctcacctgcaaccccggatcaacaaattgtggaagaa
gccagaaacgacatcccagaaagtggaccaaattcgaaagaccaggaaagtgtagagatt
gtagctgaaaagattaagccaaaagatactgaactgagccaggaatcagattttaaagaa
attaaaatcagtgcagagaaacccaaaccagaagaaaacaaaagaatggaacccattgct
attattattacggacactgaaattagtgaatttgacgttacaaaatctaaaaatgtccct
aagccattcttaatgtcagttgaaaatgaggaagtcgggggttttgctgagtgtggtttt
gagggtagaacttcagaacaatatgaaacactcttaatacaaacagcctcttctcttgtc
aagaatgctatccagctgtctatagaacagctggttaatgaaatggcctctgatgacaat
aaaataaacaatcttctacagtga

DBGET integrated database retrieval system