KEGG   Miniopterus natalensis: 107546515
Entry
107546515         CDS       T05883                                 

Gene name
LVRN
Definition
(RefSeq) aminopeptidase Q isoform X1
  KO
K13724  aminopeptidase Q [EC:3.4.11.-]
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107546515 (LVRN)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     107546515 (LVRN)
Peptidases and inhibitors [BR:mna01002]
 Metallo peptidases
  Family M1
   107546515 (LVRN)
SSDB
Motif
Pfam: ERAP1_C Peptidase_M1 Peptidase_M1_N RVT_1
Other DBs
NCBI-GeneID: 107546515
NCBI-ProteinID: XP_016080426
Position
Unknown
AA seq 807 aa
MQYMVLELREALRPGSLYELRLSFSGRASQSTREGLFTNVYTDRGERRVLLASQMEPTFA
RNVFPCFDEPALKATFNITIIHHPSYVALSNMPKLGQSEKEDVNGSKWMVTTFSITPHMP
TYLTAFAVCDYDHVTTMERGKEIRIWARKDAIANGYADFALNITGPIFSFLEDLFNISYP
LPKTDLIALPTFDDRAMENWGLLVFDESLLLLQQNDELLEAKMVISHIVSHEIGHQWFGN
LVTMNWWNNIWLNEGFATYFEFEVVSHFNSELPGNEIFFFNVLYDVLREDHTLVSRAVSL
KMENFKEMNEINELFDIFIYNKGASLARMLSSFLNENLFISALKSYLKTFSYANAEQDDL
WRHFQMAVDDQSKIVLPATVKSIMDSWTHQSGFPVITLNVSTGVMKQEPFYLGKVKNQTL
LTHNDTWIVPILWMKNGTTQPLVWLDNSSKLFPEMQVSDSDHDWVILNLNMTGYYRVNYD
KLGWKKLNEQLEKDPKAIPVIHRLQLIDDAFSLSKNNYIEIETALDLTKYLAEEDEIIVW
HTVLVNLLPRNFVSDVGNYDTYTLLKKYLLKRLTPIWNTYSTIIRENMAALQDSYLTLIS
LEKFLGTVCFLGHEDCLQLSRELFKSWMSHPGNEIPYPVKTVILCYGVALGTDKEWDFLL
NIYTNNTEEEERNQLIYAMGCSKDPWILNRYMDYAITTSLFNLSETNIIDVVAASEVGRY
VAKDFLVNNWQAVSERYGTQSLVSLMYVIGKTISTDLQVMELQQFFSPMLEEHQRLTVHA
KLQTIKNENLKNKNRSARIAAWLRKNT
NT seq 2424 nt   +upstreamnt  +downstreamnt
atgcagtacatggtgctggagctccgcgaggccctgcggcccgggagcctgtacgagctg
cggctcagcttctcgggccgcgcgtcccagagcacccgggagggcctcttcaccaacgtc
tacaccgaccggggcgagcgcagggtcctgttagcgtctcagatggaaccaacatttgcc
aggaatgttttcccttgttttgatgaaccagctctgaaggcaacttttaatattacaatt
attcatcatccaagttatgtggctctttccaacatgccaaagctaggtcagtctgaaaaa
gaagatgtgaatggaagcaaatggatggttaccaccttttccatcacaccccacatgcca
acttatttaactgcgtttgctgtctgtgactatgaccatgtcaccacaatggaaaggggc
aaggagatacgcatttgggcccggaaagatgccatcgcaaatggatatgcagactttgct
ttgaacatcacaggtcccatcttctctttcctggaagatttatttaatattagttaccct
cttccaaaaacagatctgattgccttgcctacttttgacgaccgtgcaatggaaaattgg
ggactattggtgtttgatgagtcattattgttgctgcaacaaaatgatgaactactagaa
gcaaagatggtgatctcccacattgtctcccacgagatcggacatcagtggtttggaaac
ttggttaccatgaattggtggaacaatatctggctcaatgaaggttttgcaacttatttt
gagtttgaagtagttagccacttcaattctgaactcccaggaaatgagatcttttttttt
aatgttttatatgatgttctcagagaagatcacaccctcgtgtctagagctgtatccttg
aagatggaaaatttcaaagaaatgaatgaaataaatgagctctttgacatatttatttac
aataagggagcgtctttggcccggatgctttctagcttcctgaatgagaatttatttatc
agcgcacttaagtcgtatctgaagacattttcttacgcaaatgctgagcaagatgatcta
tggaggcattttcaaatggccgtagatgaccagagtaaaattgttttgccggcaacagtc
aaaagtataatggacagctggacacaccagagtggttttccagttatcaccttaaatgta
tctactggtgtcatgaaacaggagccattttatcttggaaaggttaaaaatcagactctt
ctaacccacaatgacacatggattgtacctattctttggatgaaaaatggaactacacag
cctttagtctggctagataacagcagcaaattattccctgaaatgcaagtttcagattct
gatcatgactgggtgattttaaatttgaatatgactggatattatagagttaactatgat
aaattaggttggaagaaattaaatgaacagcttgaaaaagatcctaaggccatccccgtt
attcacagactgcagttgatagatgacgccttttccctgtctaaaaacaattatattgag
attgaaacagcacttgatttaaccaagtaccttgctgaagaagatgaaatcatagtatgg
catacagtcttggtgaacctgctacccaggaattttgtttctgatgtgggcaactatgat
acatacacattattaaagaagtatctactaaagagacttaccccaatatggaatacttat
tcaactataatccgtgaaaatatggcagcattgcaagatagctatttaactctaatatca
ctggaaaaatttctggggactgtatgtttcttgggccatgaggactgtcttcagctgtcc
agagaactcttcaaaagctggatgagccatccaggaaatgaaataccttatccagttaaa
actgtgattttatgttatggcgttgccttgggaaccgataaagaatgggattttttgtta
aatatctacactaataacacagaggaagaagaaaggaatcaacttatttatgcaatgggc
tgcagtaaagacccatggatacttaacagatatatggactatgccatcactacgtcttta
ttcaatttgagtgaaacaaatataatcgacgttgtggcagcatctgaagttggccggtat
gtcgcaaaagactttttggtcaacaattggcaagctgtgagtgagaggtatggaacacaa
tcattggtttctctaatgtatgtaatagggaaaaccatcagtacagatttacaggtcatg
gagctgcagcagtttttcagtcccatgttggaggagcaccagaggctcacagttcatgcc
aaattacagacaataaagaacgaaaatctgaaaaacaaaaaccgaagtgccaggatagct
gcatggctacggaaaaacacataa

DBGET integrated database retrieval system