KEGG   Mycolicibacterium neoaurum: D174_01070Help
Entry
D174_01070        CDS       T02959                                 

Definition
(GenBank) dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mne  Mycolicibacterium neoaurum
Pathway
mne00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    D174_01070
Enzymes [BR:mne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     D174_01070
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     D174_01070
    1.1.1.-  
     D174_01070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AHC23265
UniProt: V5X476
Position
complement(220964..222004)
Genome map
AA seq 346 aa AA seqDB search
MKAAVYYGPNKVDVTDVPEPEPGPGTVKVQVGYNGICGTDLHEYYAGPIFVPTEPHPLTG
AQLPIVMGHEFSGTITALGEGVTGWAEGDRVAIEPIYRCGRCGPCLAGTYNICAQIGFHG
LMSDGGMAEYTVVPTDMLHKLPDNVSLELGALVEPMSVAYHAATLGDPDPDRTAMVFGAG
PIGIGLWFALRGKGIEDVFVVEPSATRRSAIEALGARTLDPTALDVPGFIADHTDGHGAG
AVYDAAGVAPAVETALACVGARKAMVSVAIYEKPLTTPLLNLVMNESRIQGSLCYTAADF
QAVIGLMAEGAYDTTGWVTAIGLDDVIDEGFEALHAGTKMKVLVQP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtgtattacggacccaacaaagtggatgtcaccgacgtccccgaaccg
gagcccgggccgggaacggtgaaggtgcaggtcggctacaacggcatctgcggcaccgac
ctgcacgagtactacgcgggccccatcttcgtgccgaccgaaccgcatccgttgaccggt
gcgcaactgcccatcgtgatgggccacgagttctccgggaccatcaccgcgctcggcgag
ggggtcaccgggtgggccgagggcgaccgggtcgccatcgagccgatctaccgctgcgga
cggtgcggaccatgtctggccggcacctacaacatctgcgcacagatcggatttcacggt
ctgatgtccgacggtgggatggccgagtacacggtggtgccgaccgacatgctgcacaag
ctgcccgacaatgtctcgctcgaactcggcgccctggtcgaaccgatgtcggtggcctat
cacgccgccaccctcggcgatcccgaccccgaccgcaccgccatggtgttcggtgccgga
ccgatcggtatcggcctctggttcgcgctgcgcggcaaaggcatcgaggatgtgttcgtc
gtcgaaccctcggcgacgagacggtcggccatcgaggcgctcggtgcccgcacgctggat
ccgacggcactggacgtcccgggcttcatcgccgatcacaccgacgggcatggcgcgggc
gcggtatacgacgccgccggtgtcgcaccggcggtcgagaccgccctggcatgcgtcggg
gcgcgcaaggcgatggtcagcgtcgcgatctacgagaagccgctgaccaccccgctgctg
aacctggtgatgaacgaatcccggatccagggctcattgtgttacaccgcagccgatttc
caggccgtcatcggtctgatggccgagggcgcctacgacaccaccggctgggtgaccgcc
atcggcctcgacgatgtcatcgacgagggcttcgaggccctgcatgccggaaccaagatg
aaagtactggtgcaaccatga

DBGET integrated database retrieval system