KEGG   Mycolicibacterium neoaurum: D174_02890Help
Entry
D174_02890        CDS       T02959                                 

Definition
(GenBank) arylamine N-acetyltransferase
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mne  Mycolicibacterium neoaurum
Pathway
mne00633  Nitrotoluene degradation
mne01100  Metabolic pathways
mne01110  Biosynthesis of secondary metabolites
mne01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mne00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    D174_02890
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    D174_02890
Enzymes [BR:mne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     D174_02890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: AHC23596
UniProt: V5X7G5
Position
612389..613213
Genome map
AA seq 274 aa AA seqDB search
MTVDVAAYFARVGYSGDGAPTLDTLQVLHAAHNRSIPFENLDPVLGTPVVDLGADALFAK
LVDRRRGGYCYEQNGLFGYVLEALGFGVARLTGRVVWMQEPGAALPAETHNVLAVSVPGR
DGRYLCDVGFGGQTLSSPIRLEAGPVQQTRHEPYRLVATSPDALRLEALVREKWQALYVF
TTEPRPRIDLEVGSWYVSTYPKSVFVAGLSAALVTDDARWNLRGRQLAVHGKGGTERIDL
AGADEVVDQLVHRFGLDLTGLGDVAAGISRVLGN
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgatgtggccgcctacttcgcccgggtcgggtactccggcgatggcgcgccc
accctggatacgctgcaggttctgcacgccgcacacaaccggagcatcccgttcgagaac
ctcgatccggtgctgggcacacccgtggtggacctcggtgccgacgcgttgttcgccaaa
ctggtcgaccgccgccgcggcggatactgctacgagcagaacggactgttcggctacgtc
ctcgaggcgctcgggttcggggtggcgcggctgaccggccgcgtggtgtggatgcaggaa
ccgggcgctgcgctgcctgccgaaacgcacaacgtgctcgccgtgagcgtccccgggcgt
gacggtcgctacctgtgtgacgtggggttcggcggccagacgctgtcgtcaccgatccgg
ttggaggccggacccgtgcaacagacccggcatgagccctaccgcctggtcgccaccagt
cctgatgccttgcggctggaggccttggtgcgcgagaagtggcaggccctgtacgtcttc
accaccgagccgcgaccgcgcatcgatctggaggtcggcagctggtacgtctcgacctac
ccgaagtcggtgttcgtcgccgggttgtcggcagctctggtgaccgacgacgcgcgctgg
aacctacgcggcagacagctcgccgtgcacggcaagggcggcaccgaacgcatcgacctc
gccggggccgacgaggtcgtcgatcagctggtgcaccggttcgggctggatctcaccggc
ctcggcgatgtggcggccggcatcagtcgcgtgctggggaactga

DBGET integrated database retrieval system