KEGG   Mycolicibacterium neoaurum: D174_06685Help
Entry
D174_06685        CDS       T02959                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mne  Mycolicibacterium neoaurum
Pathway
mne03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mne00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    D174_06685
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mne03011]
    D174_06685
Ribosome [BR:mne03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    D174_06685
  Bacteria
    D174_06685
  Archaea
    D174_06685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AHC24287
UniProt: V5X8E0
Position
1386280..1386741
Genome map
AA seq 153 aa AA seqDB search
MTTAIEYPSAKAVARFVPFSPTKARRVIDLVRGKSVAEALDILRWAPQDASTTVAKVIAS
AAANAQNNDGLDPSTLVVATIFADGGPTAKRIRPRAQGRAFRIRKRSSHITVIVESRPPK
QKGGASTSTARTRRAQGSKAAAAKATDSKEGSE
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgactactgcaattgagtatccgtccgcgaaggcggtggcacgcttcgtgccgttctcg
ccgaccaaggctcgccgggtcatcgacctggtccgcggcaagtccgtggccgaggcgctc
gacatcctgcggtgggcaccgcaggacgccagcaccacggtggccaaggtgatcgccagc
gcagctgccaacgcgcagaacaacgacggcctggacccgtcgaccctcgtggtcgcgacg
atcttcgccgacggcggtccgaccgccaagcgcatccgtccgcgcgcccaggggcgtgcc
ttccggatccgcaagcgctccagccacatcaccgtgatcgtggaaagccgtccgcccaag
cagaagggtggcgcgtcgacatcgaccgcgcgtacccgtcgtgcgcagggcagtaaggct
gctgctgcgaaggccaccgattcgaaggagggctcggagtag

DBGET integrated database retrieval system