KEGG   Mycolicibacterium neoaurum: D174_11390Help
Entry
D174_11390        CDS       T02959                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
mne  Mycolicibacterium neoaurum
Pathway
mne00020  Citrate cycle (TCA cycle)
mne00620  Pyruvate metabolism
mne01100  Metabolic pathways
mne01110  Biosynthesis of secondary metabolites
mne01120  Microbial metabolism in diverse environments
mne01200  Carbon metabolism
Module
mne_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mne_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D174_11390
   00620 Pyruvate metabolism
    D174_11390
Enzymes [BR:mne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     D174_11390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AHC25150
UniProt: V5X9M6
Position
2393076..2394569
Genome map
AA seq 497 aa AA seqDB search
MSDSKTVKTDVVLVGAGIMSATLSALLRLLEPNWSITLVERLDGAAAESSDPWNNAGTGH
SALCELNYTPQNSDGTVDIAKAVNVNEQFQVSRQFWTYAVENGVLPDVRNFLNPIPHVSF
VEGADNVAYLRARYEALVSNPLFSAMEYIDDTDEFTRRLPFMAAKRTFAEPVALNWTQSG
TDVDFGSLSRQLIGYTASQGMTTLFGHDVRDLSKDSDGGWTVKVINRRTRAKHKIKAKFV
FVGAGGGALPLLQKAGIPEAKGFGGFPVGGQWLRSANPDLTAGHQAKVYGAPPLGAPPMS
VPHLDTRVINGKSYLLFGPFAGWSPKFLKQGKVTDLPLSVKPNNLASMVGVGLTEMSLLK
YLIGQLLLSEADRVDALREFAPNAVDSDWELDIAGQRVQVIRRKGAGGVLEFGTTVLTAA
DGSIAGLLGASPGASTAVPAMLEVMERCFADRYPTWLPKLKEMVPSLGTKLSGEPALFRE
IWDHGTKVLKLDAPAPV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgactcgaagaccgtgaagacggacgtggtactcgtcggtgccggcatcatgagc
gccaccctgagtgctctgctgcgcctgctcgaaccgaactggtcgatcaccttggtcgag
cgcctcgacggtgcggccgccgagagcagtgacccgtggaacaacgcgggcaccggccac
tcggcgctctgtgagctgaactacacgccgcagaattccgacggtaccgtcgacatcgcc
aaggcggtcaacgtcaacgagcagttccaggtctcgcgccagttctggacctacgccgtc
gagaacggcgtgctgcccgacgtgcgcaacttcttgaacccgatcccacacgtcagcttc
gtcgagggcgccgacaacgtcgcctacctgcgcgcccggtacgaggcgttggtgtccaac
ccgctgttctcggccatggagtacatcgacgacaccgacgagttcacccgtcggctgccc
ttcatggccgccaagcggacgttcgccgagccggtcgccctgaactggacgcaatccggc
accgatgtcgatttcggctcgctgtcgcgccagctgatcggttacaccgcaagccagggc
atgaccacgctcttcggccacgacgtgcgcgatctgtccaaggattccgacggcggttgg
acggtcaaggtgatcaatcggcgcacccgggccaagcacaagatcaaggcgaagttcgtg
ttcgtcggcgcgggcggcggtgcgcttccgctgctgcagaaggcgggcatccccgaggcc
aagggattcggcggcttccccgtcggcggtcagtggctgcggtcggccaatcccgatctc
acggccggacaccaggccaaggtctacggcgcgccgccgctgggcgccccgccgatgtcg
gtgccccacctggacacccgggtgatcaacggcaagtcctacctgctgttcgggccgttc
gccgggtggtcgccgaagtttctcaagcagggcaaggtcaccgacctgccactctcggtg
aaacccaacaacctcgcctcgatggtgggtgtcggactcaccgagatgagcctgctgaag
tacctgatcggccagctgttgctcagcgaggccgatcgggtcgacgcgctgcgtgaattc
gcacccaacgcagtcgattcggattgggagctggacatcgccggtcagcgtgtgcaggtg
atccggcgcaagggtgccggtggtgtgctggaattcggcaccaccgtgctcaccgccgcc
gacggcagcatcgccggtctgctcggtgcgtcccccggcgcgtcgaccgcggtgccggcc
atgctcgaggtgatggagcgctgcttcgccgaccgatacccgacctggctgcccaagctc
aaggagatggtgccctcgctggggaccaagctctccggtgagcccgcactgttccgcgag
atctgggatcacggcaccaaggtgctcaaactcgatgcaccagcgcccgtatga

DBGET integrated database retrieval system