KEGG   Mycolicibacterium neoaurum: D174_18190Help
Entry
D174_18190        CDS       T02959                                 

Definition
(GenBank) acid phosphatase
  KO
K22316  ribonuclease H / adenosylcobalamin/alpha-ribazole phosphatase [EC:3.1.26.4 3.1.3.73]
Organism
mne  Mycolicibacterium neoaurum
Pathway
mne00860  Porphyrin and chlorophyll metabolism
mne01100  Metabolic pathways
mne03030  DNA replication
Module
mne_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:mne00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    D174_18190
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    D174_18190
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mne03032]
    D174_18190
Enzymes [BR:mne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     D174_18190
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     D174_18190
DNA replication proteins [BR:mne03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     D174_18190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 RVT_3 RNase_H DUF459
Motif
Other DBs
NCBI-ProteinID: AHC26376
UniProt: V5XFA2
Position
complement(3816065..3817123)
Genome map
AA seq 352 aa AA seqDB search
MRVVVEADGGSRGNPGPAGYGAVVFNADRSAVLAERRQSIGRATNNVAEYRGLIAGLEAA
AELDATEVAVYMDSKLVVEQMSGRWRVKHPDLLELHREATQAARRFADVQYAWIPRAQNA
HADRLANEAMDGADSAPVPNSSPGWSGARGEPTQMLLLRHGQTELSVERRYSGRGNPALT
ELGRTQADAAARYLGTLGPVSAVLSSPLQRAQETAAAAAKVLDLDVTVDDGLIETDFGSW
EGLTFSEAAQQDPDLHRQWLRDTSVAPPGGESFDSVAERVRDARNRIIAEYAGSTVLVVS
HVTPIKTLLRLALDGGSGILYRLHLDLASLSIAEFYPDGLASVRLVNQTSYL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgagggttgtcgtcgaggccgacggtgggtcccgcggtaacccgggtccggccggctac
ggtgcggtggtcttcaacgccgaccgctcggcggtgctggccgagcggcggcagtcgatc
ggccgtgccaccaacaatgtcgccgagtaccgcggattgatcgccggtctggaagcggcc
gcggaactcgacgccaccgaggtcgcggtgtacatggactccaagctcgtcgtcgagcag
atgtcgggtcgctggcgtgtcaaacacccggatctgctggaacttcatcgcgaagcaacc
caggcggcacgacgcttcgccgatgtgcagtacgcgtggatcccgcgggcgcagaacgcg
cacgccgaccgattggccaacgaggcgatggacggtgcggattcggcgccggtgccgaac
tcctcgccgggctggagcggtgcgcgcggtgagccgacgcagatgctgctcttacgccac
gggcagaccgaattgtcggtcgagcgacggtattcggggcggggcaatccggcgctgacc
gagctgggccgaacccaggccgacgccgcggcacggtatctgggcaccctgggcccggtg
tcggcagtgctgtcctcgccgctgcaacgcgcgcaggagaccgccgcggcggcggcgaag
gtgctggatctggatgtgacggtcgacgacggactgatcgaaaccgacttcggctcgtgg
gagggtctgaccttcagcgaagccgcgcaacaggatccggatctgcaccgccaatggttg
cgcgacaccagcgtggccccgcccgggggtgagagcttcgattctgtcgccgagcgggtg
cgggacgcgcgcaatcgcatcatcgccgagtacgccggttccaccgtgctggtggtgtcg
catgtgacgcccatcaagaccctgctgcgcctggcgctcgatggcggctcgggaatcctg
taccggctgcatctggatctggcgtcgttgagcatcgccgagttctatcccgacggtctg
gcttcggtgcggctggtgaaccagacgtcgtatctctag

DBGET integrated database retrieval system