KEGG   Mycolicibacterium neoaurum: D174_22505Help
Entry
D174_22505        CDS       T02959                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mne  Mycolicibacterium neoaurum
Pathway
mne00071  Fatty acid degradation
mne00072  Synthesis and degradation of ketone bodies
mne00280  Valine, leucine and isoleucine degradation
mne00310  Lysine degradation
mne00362  Benzoate degradation
mne00380  Tryptophan metabolism
mne00620  Pyruvate metabolism
mne00630  Glyoxylate and dicarboxylate metabolism
mne00640  Propanoate metabolism
mne00650  Butanoate metabolism
mne00900  Terpenoid backbone biosynthesis
mne01100  Metabolic pathways
mne01110  Biosynthesis of secondary metabolites
mne01120  Microbial metabolism in diverse environments
mne01130  Biosynthesis of antibiotics
mne01200  Carbon metabolism
mne01212  Fatty acid metabolism
mne02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D174_22505
   00630 Glyoxylate and dicarboxylate metabolism
    D174_22505
   00640 Propanoate metabolism
    D174_22505
   00650 Butanoate metabolism
    D174_22505
  09103 Lipid metabolism
   00071 Fatty acid degradation
    D174_22505
   00072 Synthesis and degradation of ketone bodies
    D174_22505
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D174_22505
   00310 Lysine degradation
    D174_22505
   00380 Tryptophan metabolism
    D174_22505
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    D174_22505
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D174_22505
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    D174_22505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mne04147]
    D174_22505
Enzymes [BR:mne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     D174_22505
Exosome [BR:mne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D174_22505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AHC27145
UniProt: V5XFE5
Position
complement(4732609..4734138)
Genome map
AA seq 509 aa AA seqDB search
MVDPRTPVIVGVGQFTERIDDDGYRGMSSVELATEAARAAVADTGADSATIAAAIEVFVG
LRQFEICTPFSEAPLGCSDNYPRSVAARIGADPARAVLEPLGGHGSQKVTTEFAGVIAAG
DAEVVLVLGSENGSTLRHFAGREDKPDHSETIGGQLEDRGYGFDQYMNEYTATHGLTGAP
VQYGLLDNARRARIGATVADYRRQMAELFAPFSEVAAKNPLASSPVERTVDELATVTPEN
RMICDPYPRLMVARDQVNQGAAVLLMSVAAARRLSVPEEKWVYLHGHADLVEQSLLDRAD
LSASLSAEMAVAEALRVAEVELSEVSTFDLYSCFPFPVFSVCDSAGLAPDDPRGLTLTGG
LPFFGGPGNSYSLHGIAETVCSAREQPGRFGLVGANGGVMSKYSVGVYSTVPVDWRTDRS
RELQSRIDEQPMVAVTRHPEGRGTIETYSVRYDWPTTTGVIIGRLDADGSRFMALTTDED
LLALMADGDPLGAAITVTAGEKENHATLA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtggatccgcgtaccccggtgatcgtcggcgtgggacagttcaccgaacgcatcgat
gacgacggctaccgagggatgtcctcggtggagttggccaccgaggcggcccgggcggcg
gtggccgacaccggtgcggactcggcgaccatcgccgccgccatcgaggtcttcgtcggg
ctgcgccaattcgagatctgcacgccgttctccgaggcgccgctgggctgttcggacaac
tacccgcggtcggttgccgcacgtatcggcgccgaccctgcccgcgcggtgctggaaccg
ctcggcgggcacggatcgcagaaggtgaccaccgagttcgccggagtcatcgccgccggt
gatgccgaggtcgtgctggtgctgggatccgaaaacggttcgacactgcgccatttcgcg
ggccgcgaggacaagccggaccactccgagacgattggtggccagctggaggatcgtggc
tacggattcgaccagtacatgaacgagtacaccgccacccacggtctgacgggtgcgccc
gtgcagtacggactgctggacaacgcccgccgagcgcgcatcggtgccacggtggccgac
taccgccgtcagatggccgagctcttcgcgccgttctcggaggtcgccgccaagaacccg
ttggcgtcatcaccggtggaacggaccgtggacgaactcgccaccgtcacaccggaaaac
cggatgatctgtgacccttacccgcgcctgatggtggcccgcgaccaggtgaaccagggc
gccgcggtgctgttgatgtcggtggccgccgcacgccggctgtcggtgcccgaggagaag
tgggtatacctgcacggtcatgccgacctcgtcgaacaatccctgctcgaccgcgccgac
ctgagcgccagtctctcggcggaaatggctgtggcagaggcgcttcgcgtggccgaggtg
gagctttccgaggtatccaccttcgacctctacagctgcttccccttcccggtgttctcg
gtgtgcgactcggccggactggcgcccgacgacccgcgcggcctcaccctcaccggaggg
ctgcccttcttcggcggcccgggcaacagctactccctgcacggcatcgccgagacggtg
tgcagcgcccgggagcagccgggccgattcggcctcgtcggcgccaacggcggtgtgatg
agcaaatattcggtcggcgtgtactcgaccgtgccggtcgactggcgtaccgaccgcagc
cgggaactgcagtccaggatcgacgaacagccgatggttgcggtcacccggcaccccgaa
ggtcgcggcacgatcgaaacgtactcggtgcgttacgactggccgacgaccaccggggtc
atcatcggcaggctcgacgccgacggcagccggttcatggcgctgaccaccgacgaggat
ctgctcgccctgatggccgacggcgacccgctcggtgccgcgatcacggtgaccgcgggg
gagaaggagaaccacgccacgctggcgtga

DBGET integrated database retrieval system