KEGG   Mycolicibacterium neoaurum: D174_22525Help
Entry
D174_22525        CDS       T02959                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mne  Mycolicibacterium neoaurum
Pathway
mne00020  Citrate cycle (TCA cycle)
mne00640  Propanoate metabolism
mne00660  C5-Branched dibasic acid metabolism
mne01100  Metabolic pathways
mne01110  Biosynthesis of secondary metabolites
mne01120  Microbial metabolism in diverse environments
mne01130  Biosynthesis of antibiotics
mne01200  Carbon metabolism
Module
mne_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mne_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D174_22525
   00640 Propanoate metabolism
    D174_22525
   00660 C5-Branched dibasic acid metabolism
    D174_22525
Enzymes [BR:mne01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     D174_22525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AHC27149
UniProt: V5XIB4
Position
complement(4737828..4738991)
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTESAEDAKAIAEEIGKPVMVKAQVKVGGRGKAGGVK
YAATPADALEHANNILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRSNRTYLAMCSVE
GGMEIEEVAATKPDRLAKVPVDAVKGVDLAFAREIAEKGHLPAEVLDAAAVTIQKLWEVF
VGEDATLVEVNPLVRTPDDQILALDGKVTLDANADFRQPGHAEFEDKDATDPLELKAKEN
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMANGLD
VILGDSQVKSVFVNVFGGITSCDAVANGIVKALEILGDEANKPLVVRLDGNNVDEGRRIL
AEANHPLVVQAETMDAGADKAAELANK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatctgttcgagtaccaggcgaaggaactcttcgccaagcacaacgtaccgaccacg
ccgggccgggtcaccgagtccgccgaggacgccaaggcgatcgccgaggagatcggcaag
ccggtcatggtcaaggctcaggtgaaggtcggcggccgcggtaaggccggcggcgtgaag
tacgcggccacccccgccgacgcgctggagcacgccaacaacatcttgggcctggacatc
aagggccatgtcgtgaagaagctgttggtcgccgaggccagcgacatcgccgaggagtac
tacatctccttcctgctggaccgctccaaccgcacctacctggccatgtgctcggtcgag
ggcggcatggagatcgaagaggtcgccgcgaccaagcccgaccggctggccaaggttccc
gtcgacgccgtcaagggcgtcgatctggccttcgctcgcgagatcgccgagaagggccac
ctgcccgccgaggtgctcgatgccgccgccgtcaccatccagaagctctgggaggtgttc
gtcggcgaggacgccaccctggtggaggtcaacccgctggtgcgtacccccgacgatcag
atcctggcgctggacggcaaggtcaccctcgacgccaacgccgacttccgccagcccggc
cacgccgagttcgaggacaaggacgccaccgatcccctcgagctcaaggccaaggagaac
gacctcaactacgtcaagctcgacggtgaggtcggcatcatcggcaacggtgcgggtctg
gtcatgtcgaccctcgacgtcgtcgcctacgccggtgagaagcacggcggcgtgaagccc
gccaacttcctcgacatcggcggcggcgcctcggccgaggtgatggccaacggtctggat
gtgatcctcggcgacagccaggtcaagagcgtgttcgtcaacgtcttcggtggcatcacc
tcgtgtgacgccgtcgccaacggcatcgtgaaggcgctggagatcctcggcgacgaggcc
aacaagccgctggtcgtgcgtctcgacggcaataacgtcgacgagggtcgccgcatcctg
gccgaagccaatcatccgctggtcgtacaggccgaaaccatggacgccggcgccgacaag
gccgccgagctggccaacaagtaa

DBGET integrated database retrieval system