KEGG   Mycolicibacterium neoaurum: D174_24185Help
Entry
D174_24185        CDS       T02959                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mne  Mycolicibacterium neoaurum
Pathway
mne00071  Fatty acid degradation
mne00072  Synthesis and degradation of ketone bodies
mne00280  Valine, leucine and isoleucine degradation
mne00310  Lysine degradation
mne00362  Benzoate degradation
mne00380  Tryptophan metabolism
mne00620  Pyruvate metabolism
mne00630  Glyoxylate and dicarboxylate metabolism
mne00640  Propanoate metabolism
mne00650  Butanoate metabolism
mne00900  Terpenoid backbone biosynthesis
mne01100  Metabolic pathways
mne01110  Biosynthesis of secondary metabolites
mne01120  Microbial metabolism in diverse environments
mne01130  Biosynthesis of antibiotics
mne01200  Carbon metabolism
mne01212  Fatty acid metabolism
mne02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mne00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    D174_24185
   00630 Glyoxylate and dicarboxylate metabolism
    D174_24185
   00640 Propanoate metabolism
    D174_24185
   00650 Butanoate metabolism
    D174_24185
  Lipid metabolism
   00071 Fatty acid degradation
    D174_24185
   00072 Synthesis and degradation of ketone bodies
    D174_24185
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D174_24185
   00310 Lysine degradation
    D174_24185
   00380 Tryptophan metabolism
    D174_24185
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    D174_24185
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D174_24185
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    D174_24185
Enzymes [BR:mne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     D174_24185
Exosome [BR:mne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D174_24185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Peptidase_M22
Motif
Other DBs
NCBI-ProteinID: AHC27458
UniProt: V5XHY1
Position
5082958..5084133
Genome map
AA seq 391 aa AA seqDB search
MAGQLAAVLGTGQTKYVAKRHDVSMNGLVREAIDRALADSGSTFDDIDAVVVGKAPDFFE
GVMMPELFMADATGATNKPLIRVHTAGSVGGSTAIVAASLVQSGKYKRVLTMAWEKQSES
NAMWALSIPVPFTKPVGAGAGGYFAPHIRAYIRRSGAPNHIGAIVAVKDRLNGAKNPLAH
LHQPDITVEKVMQSPMLWDPIRYDETCPSSDGAAALVIGNEEAAEAHLANGNPVAWIHAT
ALRTEPLAYAGRDQVNPQASRDAAAALWRDAGITSPIDEIDAAEVYVPFSWYEPMWLESL
GFAAEGEGWKLTEAGETAIGGRIPFNASGGVLSSNPIGASGMIRFAESAIQVMGKGGDHQ
VPGARKALGHAYGGGAQYFSMWVVGADKPTR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggtcagctggccgcggtgctgggcaccgggcagacgaaatacgtcgccaagcgc
cacgatgtgtcgatgaacggcctggtgcgcgaggccattgacagggcgctggccgattcc
ggctcgacgttcgacgatatcgacgccgtggtggtcggcaaggcgcccgacttcttcgag
ggcgtcatgatgcccgagctgttcatggccgacgcgaccggcgcgaccaacaaaccgctg
atccgggtgcacaccgccgggtcggtgggcgggtcgaccgcgatcgtggcggccagcctg
gtgcagtcgggcaagtacaagcgcgtgctgacgatggcctgggagaagcagtcggaatcg
aatgccatgtgggcgttgagcattccggtgcccttcaccaagccggtcggcgccggcgcc
ggcgggtacttcgccccgcacatccgcgcctatatccgccgctccggggcgcccaaccac
atcggggcgatcgtggccgtcaaggaccgtctcaacggcgccaagaacccgttggcacat
ctgcatcagcccgatatcaccgtcgagaaggtgatgcagtccccgatgctgtgggacccg
atccgctatgacgagacctgcccgtcctccgacggtgcggccgccctggtgatcggcaac
gaggaggccgccgaggcgcacctggccaacggcaatccggtggcgtggatccacgccacc
gcgctgcgtaccgagccgctggcctacgccggtcgcgatcaggtcaatccgcaggccagt
cgcgatgccgcggccgcgctgtggcgcgatgccggcatcacctcaccgatcgacgagatc
gatgccgccgaggtgtacgtcccgttctcctggtacgaaccgatgtggctggagagcctg
ggcttcgcggccgagggcgagggctggaagctcaccgaggccggcgagaccgccatcggc
gggcggatcccgttcaacgcctccggtggtgtgctgtcctcgaacccgatcggcgcctcc
ggcatgatccggttcgccgagtcggccatccaggtgatgggcaagggcggcgatcatcag
gttccgggtgcccgcaaggcactgggtcacgcctatggcggcggcgcgcagtacttctcg
atgtgggtcgtcggggccgacaagcccacccggtga

DBGET integrated database retrieval system