KEGG   Mycolicibacterium neoaurum: D174_25775Help
Entry
D174_25775        CDS       T02959                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
mne  Mycolicibacterium neoaurum
Pathway
mne00260  Glycine, serine and threonine metabolism
mne01100  Metabolic pathways
mne01110  Biosynthesis of secondary metabolites
mne01120  Microbial metabolism in diverse environments
mne01130  Biosynthesis of antibiotics
mne01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    D174_25775
Enzymes [BR:mne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     D174_25775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AHC27748
UniProt: V5XIQ4
Position
5418734..5419798
Genome map
AA seq 354 aa AA seqDB search
MPITTLHDPGRRGFASDNYAGVHPEVIAAITAANGGHEIAYGQDAYTARLQEVIRTHFGA
AAETFPVFNGTGANVVALTGLLPRWGAVITAHTAHINTDEGGAPERVMGHKLLTVPTPDG
KLTPDLIAREAYGWGDEHRAQPLAVSITQSTEMGTLYTPDEVRAIADFAHSHGMSVHADG
ARLWNAAAALDVPFREFTTDAGVDVVSLGGTKNGLLAAEAVVVLAPDRVSGLVYLRKLTM
QLSSKMRFASAQLLSLFDDDLGLRSARHANAMAARLRTALEADPPPGLTFTQATEANAIF
ATIPNDAADRIRDRVRFYDWDRARGEVRWMTAWDNTTDDVDNFVDIIRAELRRG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgcccatcaccacacttcacgatcccggtcgacgcggtttcgccagcgacaactatgcg
ggcgtacatcccgaggtcatcgcagcgatcaccgcggccaacggcggacacgagatcgcc
tacggccaggacgcctacacggcccggctgcaggaggtcatccgcacccacttcggtgca
gccgccgagaccttccccgtgttcaacggaaccggcgccaatgtggtggcgttgaccggc
ctgctgccgcgctggggtgccgtgatcacagcacataccgcccacatcaacaccgacgag
ggcggcgccccggaacgcgtgatgggccacaagcttctgacggtgcccaccccggacggc
aagttgacccccgacctgatagcccgggaggcttacggctggggcgacgagcaccgggcc
cagcccctggccgtcagcatcacccagtccaccgagatgggcacgctgtacaccccggac
gaggtgcgcgccatcgccgatttcgcccactcccacgggatgtcggtgcatgcggacggg
gcgcggctgtggaatgctgccgccgccctcgacgtccctttccgggagttcaccaccgat
gccggcgtcgacgtggtcagcctgggtggtaccaagaacgggctcttggccgccgaggca
gtggtggtgctggcccccgaccgcgtctctgggttggtgtacctgcgcaagctgacgatg
cagctgtcgagcaagatgcgcttcgcctcggcacagctgctgagcctgttcgatgacgat
ctgggcctgcgcagcgcacggcacgccaatgcgatggcagcccgactgcggaccgccctg
gaggccgacccaccgcccggactcaccttcacccaggccaccgaggccaacgcgatcttc
gccacgatcccgaacgacgccgccgaccgcattcgcgaccgggtgcgtttctacgactgg
gaccgggcccgcggcgaggtgcgctggatgaccgcctgggacaacaccaccgatgatgtc
gacaactttgtcgacatcatccgtgcggagttgcggcggggctag

DBGET integrated database retrieval system