KEGG   Monoraphidium neglectum: MNEG_11195Help
Entry
MNEG_11195        CDS       T05028                                 

Definition
(RefSeq) guanylate cyclase
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
mng  Monoraphidium neglectum
Pathway
mng00230  Purine metabolism
mng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mng00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MNEG_11195
Enzymes [BR:mng01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     MNEG_11195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNOB HNOBA V4R
Motif
Other DBs
NCBI-GeneID: 25728433
NCBI-ProteinID: XP_013895789
UniProt: A0A0D2LZF5
Position
Unknown
AA seq 325 aa AA seqDB search
MLGIINLAFEAFVKRDYGENVWMEIVQRCPGVATNWVSSCPYSDKAIYQLGAAAAAVLKM
SFDDVIEAFGVDFVRYAEEKGYGRLMQVLGSNVTADSLLLHYHSSRPGMWPLVAGILKGM
AEEYFGFTLGVELVASRHQGHDHEIFRLTYPHQEAIRARDDTARKAAASLFAMPPNMFYE
LHPFHLLMAEERLTLLQVGPALGRLLPEAQAGDPFGYHFKIRHPYVPVDYNAITGFFNTT
FLVNARNTMLELIGQMLPVTLPADEGTPGSEGGAGGRGGPRRALLFLGSPRCGSLSEMQA
QQLFLSDIPLHDMSRDFILLAEQRQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcatcatcaacttggccttcgaggccttcgtgaagcgggattatggcgaaaat
gtttggatggagatcgtgcagcgatgtcctggtgtggcgaccaactgggtatcctcttgt
ccatactcagacaaggcaatataccagcttggcgcggcggcggcggcggtgctgaagatg
tcctttgatgacgtgatcgaagcgtttggagtggattttgtcagatacgctgaggagaag
gggtatggccggctgatgcaagtgctgggcagcaatgtcactgcggactcgctgctgctg
cattaccactccagccggcccggcatgtggccgctggtggccggcatactgaagggcatg
gcggaggagtactttgggttcacgcttggggtggagctggtggccagcaggcaccagggg
cacgaccatgagatcttccgcctgacctacccccaccaagaggccatccgcgcccgcgac
gacaccgcgcgcaaggcggcggcctcgctgttcgccatgccgcccaacatgttctacgag
ctgcaccccttccaccttctgatggcggaggagcgcctcaccctcctgcaggtcgggccc
gcgctggggcggctgctgcccgaggcgcaggcgggagaccccttcgggtaccacttcaag
atccgccacccctatgtcccggttgattacaacgcgatcacgggctttttcaacaccaca
tttctggtcaacgcccgcaacaccatgctggagctcatcggccagatgctgccggtgacg
ctgccggcagacgaggggacaccgggcagcgagggcggcgcgggcggcaggggaggcccg
cggcgcgcgctgctgttcctggggagcccgcggtgcggtagcctcagcgagatgcaggcc
cagcagctgttcctgagtgacatccccctccacgacatgagccgcgacttcatcctgctg
gcggagcagcggcag

DBGET integrated database retrieval system