KEGG   Monoraphidium neglectum: MNEG_12269Help
Entry
MNEG_12269        CDS       T05028                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase I
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
mng  Monoraphidium neglectum
Pathway
mng00010  Glycolysis / Gluconeogenesis
mng00030  Pentose phosphate pathway
mng00051  Fructose and mannose metabolism
mng00710  Carbon fixation in photosynthetic organisms
mng01100  Metabolic pathways
mng01110  Biosynthesis of secondary metabolites
mng01200  Carbon metabolism
Module
mng_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
mng_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:mng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MNEG_12269
   00030 Pentose phosphate pathway
    MNEG_12269
   00051 Fructose and mannose metabolism
    MNEG_12269
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MNEG_12269
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mng04147]
    MNEG_12269
Enzymes [BR:mng01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MNEG_12269
Exosome [BR:mng04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MNEG_12269
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-GeneID: 25729614
NCBI-ProteinID: XP_013894712
UniProt: A0A0D2J7F1
Position
Unknown
AA seq 293 aa AA seqDB search
MRAAMQVRSASGATAAPRACAAAAPIGRAPHPARRTDRSSAAATSPAGRSTLGPWRGAAT
ASALSGAQRRRSVVAAATGGGGYDFAIETLPTWLLREEMAGRVPFDLVQVVSSIAVACKQ
ISALVARAPLAKLTGVAGGSNASGDEQKKLDVIANDIFTGAVANCGRTGITVSEEEEAPI
AVDVVAGGNYIVAFDPIDGSSNLDACISSGSIFGIYTPGECVINDDDSADEVLEKCVTNV
RKAGTELVAAGYCLYSSATVLVLTLGDGVFSFTLDRGLGEFVLTDRSAAVWLQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgccatgcaggttcgcagtgcctctggcgcgaccgccgctccccgcgcctgc
gccgcagccgcgcccattggccgcgccccgcacccggcgcgccgcaccgaccgctcctca
gccgccgccaccagccctgccggccgcagcacgctaggtccctggcgcggcgcggccacc
gccagcgctctgagcggcgcccagcggcggcggtctgttgttgccgccgccaccggcggc
ggcggctacgactttgccatcgagacgctgcctacatggctgttgcgagaggagatggcg
ggtcgggtgccgtttgatctggtgcaggtcgtgtcgtccatcgcggtggcgtgcaagcaa
atcagcgccctggtggcgcgcgcccccctagccaagctgacgggcgtggcggggggctcc
aacgctagcggggacgagcagaagaagctcgacgtcatcgccaacgacatcttcacgggc
gcggtcgccaactgcggccgcaccggcatcacggtttccgaggaagaggaggcccccatt
gcggtggacgtggtggctggcggcaactacatcgtggctttcgatccgatcgacgggtcg
tcaaacctggacgcctgcatcagcagcggctcgatcttcgggatctacaccccaggggag
tgcgtgatcaacgacgatgacagcgctgacgaggtcttggagaagtgcgtgacgaacgtg
cgcaaggccggcaccgagctggtggccgcgggctactgtctctactccagtgcgacagtc
ctggtgcttaccctgggagacggggtgttctccttcacactggatagggggctcggggag
tttgtgctcacggacaggtcagcggcagtttggctgcagtga

DBGET integrated database retrieval system