KEGG   Monoraphidium neglectum: MNEG_15067Help
Entry
MNEG_15067        CDS       T05028                                 

Definition
(RefSeq) Eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
mng  Monoraphidium neglectum
Pathway
mng03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mng00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    MNEG_15067
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mng03012]
    MNEG_15067
Translation factors [BR:mng03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    MNEG_15067
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N Rotamase_2
Motif
Other DBs
NCBI-GeneID: 25732691
NCBI-ProteinID: XP_013891916
UniProt: A0A0D2LT14
Position
Unknown
AA seq 334 aa AA seqDB search
MVLLQDNPNIVMDETSDANEEKAEAPEEGALTKVWGNLVAFVERLDDELFKSLQVIDPHT
HEYMNRLRDEPVLLALCQKVHDYLGRVGDTGSQSKVALRLVEHLYFKHQGVYDAMRRLAL
QQQQQLAAEAQAAAAAAAGAEAEAERVAAEGQDEDESPADRAAASAAAVASAGEVVVLKV
PADYTMDESGERALAALVRVIFAHGDERTKARAMLCHIYHRALHDDFYTARDLLLMSHLQ
DSVSNTDISTQILHNRTMAQLGLSAFRAGLIPEAHSCLSELYGSGHVKELLAQGIGMGKY
QEKTPEQELAEKRRQMPFHMHIRPVGAPLTRPPP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgctgcaggacaaccccaacatcgtgatggacgagacctcggacgccaacgag
gagaaggcagaggcgcccgaggagggggcgctcaccaaggtgtggggcaacctggtggcg
tttgtggagcgactggatgacgagctgttcaagagcctgcaggtcatcgacccgcacacc
cacgagtacatgaaccggctgcgcgacgagcccgtgctgctggcgctgtgccagaaggtg
cacgactacctggggcgcgtgggggacacggggtcgcagtccaaggtggcgctgaggctg
gtggagcacctgtacttcaagcaccagggcgtgtacgacgccatgaggcgcctggcgctg
cagcagcagcagcagctggccgcggaggcgcaggccgcggcggcggcggcggccggcgcg
gaggccgaggcggagcgcgtggcggcggaggggcaggacgaggacgagagccccgcggac
agggctgccgcgagcgcggccgccgtggcgagcgcaggcgaggtggtggtgctcaaggtg
cccgctgactacacaatggacgagagcggggagcgcgcgctggcggcgctggtgcgcgtc
atctttgcgcacggcgacgagcgcaccaaggcgcgcgcgatgctgtgccacatctaccac
agggcgctccacgacgacttctacacggcgcgcgacctgctgctgatgagccacctgcag
gacagcgtctccaacacggacatctccacgcagatcctgcacaaccgcacgatggcgcag
ctggggctgtccgccttccgcgcggggctcattcccgaggcgcactcgtgcctcagcgag
ctctacggcagcggccacgtcaaggagctgctcgcacagggcatcggcatgggcaagtac
caggaaaagacgcctgagcaggagctggcggagaagaggcgccagatgcccttccacatg
cacatcagacccgtgggcgccccgctgactcgccccccgccctaa

DBGET integrated database retrieval system