KEGG   Monoraphidium neglectum: MNEG_2503Help
Entry
MNEG_2503         CDS       T05028                                 

Definition
(RefSeq) Glutathione gamma-glutamylcysteinyltransferase 1
  KO
K05941  glutathione gamma-glutamylcysteinyltransferase [EC:2.3.2.15]
Organism
mng  Monoraphidium neglectum
Brite
KEGG Orthology (KO) [BR:mng00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MNEG_2503
Enzymes [BR:mng01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.15  glutathione gamma-glutamylcysteinyltransferase
     MNEG_2503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phytochelatin Phytochelatin_C Peptidase_C39_2
Motif
Other DBs
NCBI-GeneID: 25735381
NCBI-ProteinID: XP_013904478
UniProt: A0A0D2LFT1
Position
Unknown
AA seq 434 aa AA seqDB search
MCAPPPKGRKVFQEALEAGTMTGFFKLVEQLSTQDEPAFCGLASLAMVLNALSIDPRRTW
KGSWRWFHEKLLDCCLPLDKVAAEGIVLSQAACLAKCNGARVELHRAGSFTLEDFRRQLL
DCAASGEEHVVVSYSRRTFLQTGDGHFSPIGGVHAGRDLALILDTARFKYPPHWVPIPLL
FESMAAVDPSTGQPRGFLRLAVQEWPDSVLFTLELQRGAWREAARWGHEEAPAEVEALAR
AGAAEPAAILRRLAASAPLPSIGSFVAVRYASAQCAKDRCVPHAVRQQVLEELRATPLYQ
LVSDLLQGNPEAARLEFAAERLCMLLLLQPPSAWAPAAAWADPGQHAQWQKLLETSAVSI
LESEAKYLRHQFSHIGEVIAGGGDHAVEDCGTCTPPKRGGGGGGGAGGGGGGAGEGLGGP
CGPVDEHQGTGCCH
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgcccctcctcccaaaggtcgcaaggtgtttcaagaggcgctggaggccgggacc
atgacgggctttttcaagttggttgagcagctgagtacccaggacgagccagcgttctgc
ggcctggccagcctggctatggtgctcaatgcgctgtcgatagacccgcgacgaacctgg
aagggcagctggcggtggttccacgagaagctgctcgactgctgcctgccgctggacaag
gttgcggcggagggaatcgtgctttcgcaggccgcgtgcctggcgaagtgcaacggcgcg
cgcgtcgagctgcaccgcgccggcagcttcacgctggaggacttccggcggcagctgctg
gactgcgccgccagcggggaggagcatgtcgtggtgtcctacagccggcggactttcctg
cagaccggggacgggcatttcagcccgatcggcggcgtccacgccggcagggacttggcg
ctgatcttggacacggcgcgcttcaagtacccgccccactgggtccccatcccgctgctg
ttcgaatccatggccgccgtcgacccctccaccggccagccgcgcggcttcctgcgcctc
gccgtgcaggagtggcccgacagcgtgctcttcacgctcgaattgcaaaggggcgcgtgg
cgcgaggcggcgcggtgggggcacgaggaagcgccggcggaggtcgaggccctcgcgcgc
gccggcgcggccgagccggccgcgatcctccggcgcctggcggcgtccgcgcctctgccc
agcatcggctcgttcgtggcggtgcggtacgcgtcggcgcagtgcgccaaggacaggtgc
gtgccgcacgcggtgaggcagcaggtgctggaggagctgcgggcgacgccgctgtaccag
ctggtgtccgacctgctgcagggcaaccccgaggccgcccgcctcgagttcgcggctgag
aggttgtgcatgctgctgctgctgcagccgccctccgcgtgggcgcccgccgcggcctgg
gcggaccccgggcagcacgcccagtggcagaagctgctggagacgtctgcggtgagcata
ctggagtccgaagccaagtatctgcgccaccagttcagccacatcggggaggtcatcgcg
ggcggcggcgaccacgccgtcgaggactgcggcacgtgcacgccgcccaagcggggcggc
ggcggcggcggcggcgctgggggcggcggcgggggcgcaggggaggggctgggcgggccg
tgcggccctgttgatgagcaccaggggactggctgctgccattag

DBGET integrated database retrieval system