KEGG   Monoraphidium neglectum: MNEG_3694Help
Entry
MNEG_3694         CDS       T05028                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
mng  Monoraphidium neglectum
Pathway
mng00010  Glycolysis / Gluconeogenesis
mng00562  Inositol phosphate metabolism
mng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MNEG_3694
   00562 Inositol phosphate metabolism
    MNEG_3694
Enzymes [BR:mng01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     MNEG_3694
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     MNEG_3694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 25736572
NCBI-ProteinID: XP_013903287
UniProt: A0A0D2K0W6
Position
Unknown
AA seq 507 aa AA seqDB search
MMSLARRLRRRFPSLLDRPYFPKRYPIISTQVARAAQSASAFALGFFQRAGANGGRPQPV
AMSMLPKRRDAVLRFFQVCPAYLQHEDTVERWLAPWLWHHWESILPDVERRLGLPRGAAQ
PCDIDALWQLCSYEAGLLGALGGACSAFERPEAELLEWMEDVRLYETQGPGADINSRIAG
VLLADLGASLRGAAQASAAGKEPLQLARLHFAHCETLTPLLTLLGLFKAQLSGRASAAAP
GAPVVSPRQAQQEVGGVDSIVDDAALAVARRLAETRSGSSSGGANGDGLADAGSGGVGSS
SLSDGGGGALDNGSETSVGSTDSWGLESHLGASSSSSSSSSSRSSSGGGGSSGGDGAGRL
RHKHGPRAAGCAYKGRELAGGPLAPPPGWEPLPNDGGREWRGGRVAPLGGNLVVVLYQSD
SRPARHVVRFVHNEQVLAPPFCGGGTDCDLGEFLEAVVDKGAASVGQLLELCEVDRRGAG
PGQGRGAAGAAPVVTADGLQIELPSLS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcactggccaggcgcctgcgccgccgctttcccagcctgctggatcgcccctac
ttcccgaagcggtaccccattatatctacacaggtcgcccgcgccgcacagagcgcatcg
gcgtttgccctcggcttcttccagcgcgcaggggccaacggcgggcggccgcagcccgtg
gcgatgtcgatgctgcccaagcggcgcgacgcggtcctgaggtttttccaggtgtgccca
gcctacctgcagcacgaggacacagtcgagcggtggctggcgccctggctgtggcaccac
tgggagtccatcctgccagacgttgagcgccgcctcggcctgccgcgcggcgcggcgcag
ccctgcgacatcgacgcgctgtggcagctgtgctcatacgaggccggcctgctcggcgcc
ctgggcggcgcctgcagcgcgttcgagcggcccgaggctgagctgctggagtggatggaa
gacgtgcggctgtatgagacgcaggggcccggggcggacatcaacagcaggatcgcgggt
gtgctcctggcagacctgggcgcgtccctccgcggcgctgcgcaagccagcgccgccggc
aaggagccgctgcagctggcgcggctgcactttgcgcactgtgagacgctgacgcctctc
ctgacgctgctcggcctgttcaaggcgcagctgtcagggagggcatccgcagcggcccca
ggggcgccagtggtctcgccgcgccaggcgcagcaggaggtggggggcgtggactcgatt
gtggacgacgctgcgctggcggtggcgcggcggctggcggagacccgcagtggcagcagc
agcggcggcgccaatggcgatggtttggctgacgctgggagcggcggcgtggggagcagc
agcttgagcgacggcggtggcggtgccctggataacggtagtgagacgagcgtgggcagc
acggacagctgggggctggagagccacctgggtgccagcagcagcagcagcagcagcagc
agcagcagaagcagcagcggcggcggcggcagcagcggcggcgacggcgccgggcggctg
cgccacaagcatggcccgcgagcggctgggtgcgcgtacaaggggagagagcttgccggc
ggccccctcgcgcccccgccaggctgggagccgctgcccaacgacggcgggcgcgagtgg
cgcggtgggcgcgtggcgccgcttgggggcaacctggtggtggtgttgtaccaatcagac
agccgcccggcgcgccacgtcgtgcggttcgtgcacaacgagcaggtgctggcgccgccg
ttttgcggcggcgggacagactgcgacctgggggagtttctggaggcggttgtcgacaaa
ggggcggcatctgtcgggcagctgctggaattgtgcgaggtggacaggaggggcgcgggg
cctggccagggccgcggcgccgccggcgccgcgcccgtcgtgaccgcagacggtctgcag
attgagctgccctctttgagctga

DBGET integrated database retrieval system