KEGG   Monoraphidium neglectum: MNEG_6295Help
Entry
MNEG_6295         CDS       T05028                                 

Definition
(RefSeq) DEAD-box ATP-dependent RNA helicase 50
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
mng  Monoraphidium neglectum
Brite
KEGG Orthology (KO) [BR:mng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mng03041]
    MNEG_6295
   03009 Ribosome biogenesis [BR:mng03009]
    MNEG_6295
Enzymes [BR:mng01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     MNEG_6295
Spliceosome [BR:mng03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    MNEG_6295
Ribosome biogenesis [BR:mng03009]
 Eukaryotic type
  90S particles
   Helicases
    MNEG_6295
  Pre-60S particles
    MNEG_6295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD CMS1 AAA_30 ResIII SNF2_N NDK AAA_19
Motif
Other DBs
NCBI-GeneID: 25739171
NCBI-ProteinID: XP_013900681
UniProt: A0A0D2MMB3
Position
Unknown
AA seq 482 aa AA seqDB search
MLQGRRASTCPAPAATAAVPRGASGRAPARGGGRSAGRGGRGGAGGPPPPTQQQQQQRRP
APRDDDEDEFFVDDEAAAKLRQILKRRGRDALVDERGRGLVALDKLGEAYGIPDRRERRP
KEQWQPDFGVEEGRGGDEEGGGEDGRGSEAASATRRFEGRSSGAAAVARPRRDAGGGAGA
SAGLGAAAPAGAAAGQIPVVRQNMGPDQGFFSASSWRDLGASDAVVEALRGIGITRPSHV
QAESYRALVSAKARHVALADQAGSGKTLGYLLPLLQELKQEEKKTGRPATVPGSPRILII
TPTGELAQQVQRVLKALVAAGLKLRSSIMTGGQEDEARRFKALKTQEDALKAGVDVMVST
PGRAVALLSKGALNLGRTNAIVLDEVDVLCGGEDVYREQVEPLQSAAPSSTRFVLVSATL
PQHTFEKLREVFPGLEPAFGPGLHRVSAGERMSGSPKGGRRSRPVHIGAHSRERSPSGAS
FS
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaggccgccgcgcctcgacctgcccggcgcccgccgccaccgccgctgtgccc
cgcggcgcgtccggccgcgcgcccgcccgcggcggcggcaggagcgccggtcgcggcggt
cgcggcggagccggtgggcctccgccgccgacccagcagcagcagcagcagcgccggccc
gcaccaagggacgacgacgaggacgagttcttcgtggacgacgaagctgctgcgaagctg
cggcagatcctcaagcgccgcgggcgcgacgcgctggtcgacgagcgcggccgcgggctg
gtggcactggacaagctgggggaggcttatgggatccccgacaggcgggagcggcggccc
aaggagcagtggcagccagacttcggcgtggaggagggccggggcggcgacgaggagggc
gggggcgaggacggccgcggctcggaagctgcgtcggccacgcggagattcgagggccgc
tccagcggcgccgcagcggtcgctcggccacgcagggatgcaggcggcggcgccggcgcc
tctgcagggctgggagcggcggcgccggcgggggcggccgcggggcagatcccggtggtg
cggcagaacatggggcctgaccagggcttcttcagcgccagcagctggcgggacctgggg
gcgagcgacgcggtggtggaggcgctgagggggatcggcatcacccggccatcgcacgtg
caggcggagtcctaccgcgccctcgtctccgccaaggcgcgccacgtggccctggcggac
caggcaggcagcggcaagaccctgggctacctgctgccgctgctgcaggagctgaagcag
gaggagaagaagacggggcggccggccacggtgcccggcagcccgcggatcctcatcatc
acgccgaccggggagctggcccagcaggtccagcgggtgctcaaggcgctggtggcagcc
gggctgaagctgcggtcctcgatcatgactggcggccaggaggacgaggcgcggcgcttc
aaggccctcaagacgcaggaagacgcgctgaaggcgggcgtggacgtgatggtgtcaacc
ccggggcgcgcggtggcgctgctgtccaagggcgccctcaacctcggacgcaccaacgcg
atcgtgctggacgaggtggacgtgctgtgcggcggcgaggacgtgtacagggagcaggtg
gagccgctgcagtccgccgcgccgtcatcgacgcgcttcgtcctcgtcagcgcgacgctg
ccgcagcacacctttgagaagctgcgggaggtgttcccggggctcgagcccgcgtttggg
ccggggctgcaccgagtatccgcgggtgagcgcatgtcggggtccccgaagggcgggcgg
cgcagtagaccggtacacataggcgcgcacagccgtgagcggagccccagtggtgccagc
ttctcctag

DBGET integrated database retrieval system