KEGG   Monoraphidium neglectum: MNEG_7682Help
Entry
MNEG_7682         CDS       T05028                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
mng  Monoraphidium neglectum
Pathway
mng00350  Tyrosine metabolism
mng00360  Phenylalanine metabolism
mng00380  Tryptophan metabolism
mng00950  Isoquinoline alkaloid biosynthesis
mng00965  Betalain biosynthesis
mng01100  Metabolic pathways
mng01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mng00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    MNEG_7682
   00360 Phenylalanine metabolism
    MNEG_7682
   00380 Tryptophan metabolism
    MNEG_7682
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    MNEG_7682
   00950 Isoquinoline alkaloid biosynthesis
    MNEG_7682
   00965 Betalain biosynthesis
    MNEG_7682
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mng04147]
    MNEG_7682
Enzymes [BR:mng01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     MNEG_7682
    4.1.1.105  L-tryptophan decarboxylase
     MNEG_7682
Exosome [BR:mng04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MNEG_7682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 SepSecS
Motif
Other DBs
NCBI-GeneID: 25740558
NCBI-ProteinID: XP_013899300
UniProt: A0A0D2N226
Position
Unknown
AA seq 294 aa AA seqDB search
MVLGLAHIRALPTSAASDWALRHEDLEAAISEDKAKGLIPFFACASVGTTSSCAVDPVPE
IAKVCARHGLWTHVDAAYAGCAAICPEHRSLFAGLEAVDSFQFNPHKWLVTTFDCCAMWV
ADAGALKEALSLTPIYLRTPANGLDYKDWQVPLGRRFRALKLWMVLRMYGAEKLRALIRH
HCAMAAWLADQVRADPRFEVVAPPRLGLVCFRLRDATNATNAQLAAAVNATGKMFLVATE
LDGRTTLRLVVGSPQTQPRHVSAAWDLIREQAAALLQQELTGAATAATVAARAG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggtcctcggcctggcccacatccgcgcgctgccaacctcggccgcctcggactgggcg
ctccggcacgaagatctggaggccgcgatctccgaggacaaggcgaaggggcttatccca
ttctttgcgtgcgcgagcgtcgggacgacgtcgtcctgtgcggtggacccggtgccagaa
attgcaaaggtttgcgccaggcacggcttgtggacccacgtggacgccgcgtacgcgggc
tgcgcggccatctgcccagagcacaggagcctctttgctggcctggaggctgtcgactca
ttccagttcaacccccacaaatggctcgtgactacgtttgactgttgcgccatgtgggtg
gccgacgcgggcgctctcaaggaggcgctgtcgcttacgcccatctacctgcggaccccg
gccaacggcctggactataaggattggcaggtcccacttggccgcaggttcagggcgctg
aagctgtggatggtcctgcgcatgtatggcgccgagaagctgcgcgccctcatccgccat
cactgcgccatggcggcctggctagcagaccaggtgcgcgctgacccgcggtttgaggtc
gtcgcgccgccgcggctgggcctggtgtgcttcaggctgagggatgccaccaacgccacc
aacgcacagctggcagcggcagtcaatgccacaggcaagatgttcctcgtcgcaacagag
ctcgacggccgcactaccctgcgcctcgtcgtcggcagcccccagacacagccgcgccac
gtgtccgcggcctgggacctcatccgggagcaggcggctgcgctgctgcagcaggagctg
actggcgcggcgacggcggcgacggtggccgcgcgggctgggtga

DBGET integrated database retrieval system