KEGG   Monoraphidium neglectum: MNEG_9609Help
Entry
MNEG_9609         CDS       T05028                                 

Definition
(RefSeq) heat shock 70kDa protein 1/8
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mng  Monoraphidium neglectum
Pathway
mng03040  Spliceosome
mng04141  Protein processing in endoplasmic reticulum
mng04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mng00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    MNEG_9609
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MNEG_9609
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    MNEG_9609
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mng01009]
    MNEG_9609
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mng03041]
    MNEG_9609
   03009 Ribosome biogenesis [BR:mng03009]
    MNEG_9609
   03110 Chaperones and folding catalysts [BR:mng03110]
    MNEG_9609
   04131 Membrane trafficking [BR:mng04131]
    MNEG_9609
   03051 Proteasome [BR:mng03051]
    MNEG_9609
   03029 Mitochondrial biogenesis [BR:mng03029]
    MNEG_9609
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mng04147]
    MNEG_9609
Protein phosphatases and associated proteins [BR:mng01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     MNEG_9609
Spliceosome [BR:mng03041]
 Complex B
  Other components
   Prp19 complex
    MNEG_9609
 Complex C
   Prp19-CDC5 complex
    MNEG_9609
Ribosome biogenesis [BR:mng03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    MNEG_9609
Chaperones and folding catalysts [BR:mng03110]
 Heat shock proteins
  HSP70 / DNAK
   MNEG_9609
Membrane trafficking [BR:mng04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    MNEG_9609
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    MNEG_9609
Proteasome [BR:mng03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    MNEG_9609
Mitochondrial biogenesis [BR:mng03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    MNEG_9609
Exosome [BR:mng04147]
 Exosomal proteins
  Proteins found in most exosomes
   MNEG_9609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A DUF1894
Motif
Other DBs
NCBI-GeneID: 25742484
NCBI-ProteinID: XP_013897371
UniProt: A0A0D2MBX2
Position
Unknown
AA seq 249 aa AA seqDB search
MSREGNAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPKNTVFDAKRLIGRKFSEAAVQDDIKHFSFTVKPGAGDKPMIEVLYKNETKTFSPEE
ISAMVLTKMRETAQAFLGADKPIKKAVVTVPAYFNDSQRQATKDAGTIAGLEVLRIINEP
TAAAIAYGLDKKAGGGSAGEKNVLIFDLGGGTFDVSLLSIDDGIFEVKATAGDTHLGGED
FDNRCAHAL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgaaggcaatgcaatcgggatcgacttgggcacgacctactcgtgtgtgggc
gtgtggcagaatgaccgcgtggagatcattgccaacgaccagggcaaccgcacgacgccc
tcctatgtcgcgttcactgacactgagcgcctcatcggcgacgccgccaagaaccaggtg
gcgatgaaccccaagaacacagtgtttgacgccaagcgcctgatcgggcgcaagttcagc
gaggccgcggtgcaggacgacatcaagcacttctcgttcactgtcaagcccggggccggc
gacaagcccatgatcgaggttctgtacaaaaacgagaccaagacgttcagccctgaggag
atcagcgccatggtgctcaccaagatgagggagacggcccaggcgttcctgggcgccgac
aagcccatcaagaaggccgtggtgactgtccccgcctacttcaacgacagccagcgccag
gccaccaaggacgccggcaccatcgccggcctggaggtgctgcgcatcatcaacgagccc
accgcggccgccatcgcgtacggcctggacaagaaggccggcggtggctcggccggcgaa
aagaacgtgctcatcttcgacctcggcggcggcacgtttgatgtgtcgctgctgtccatc
gacgatggcatcttcgaggtcaaggccaccgccggtgatacccacctgggcggagaggac
tttgacaacaggtgcgcgcacgcgctctga

DBGET integrated database retrieval system