KEGG   Monoraphidium neglectum: MNEG_9876Help
Entry
MNEG_9876         CDS       T05028                                 

Definition
(RefSeq) RNA helicase
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mng  Monoraphidium neglectum
Pathway
mng03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mng00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    MNEG_9876
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mng03041]
    MNEG_9876
Enzymes [BR:mng01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     MNEG_9876
Spliceosome [BR:mng03041]
 Complex C
  Other components
   Step II factors
    MNEG_9876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C DEAD AAA_22 ABC_tran AAA_19 AAA_30 DUF2075 T2SSE AAA_7
Motif
Other DBs
NCBI-GeneID: 25742751
NCBI-ProteinID: XP_013897106
UniProt: A0A0D2MB23
Position
Unknown
AA seq 439 aa AA seqDB search
MQVRANKVLIVVGETGSGKTTQIPQFLLQSGLADISGGGGGKGGWRGGRDGGGGGMIACT
QPRRVAAVTVARRVAEEMGVQLGQKVGYSIRFDDCTSPSTRIKYMTDGMLLRECLLDPLL
NKYKVVIVDEAHERTVSTDVLLGLLKGVAARRGDDFRLLVMSATLDAEAFSKYFGGARAV
WVQGRQHPVAVMCTTHPEDNYLDAALNAVLQVHCEEGPGDILVFLTGQEEIEGLERLLMD
RAAALPDGAAGRGGGPEELLVLPIYAALPPEQQMRVFDPAPAGSRKAILATNIAETSITI
PGVRYVVDTGFVKARGYHAKLGADSLQVVPVSQAQARQRSGRAGREGPGKAYRLYTLESF
KALAPTTPPEILRSNLASTVLQLKALGVEDVVGFDFMDKPPRAAVVRRALSDVCGAFCNG
GSGAVITVPFAPARPPLPV
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttcgtgccaacaaggtcctgatcgtggttggggagacaggatcggggaagacc
actcagattccacagttcctgctgcaaagcggcctcgctgacatcagcggcggcggcggc
ggcaagggcggctggcgcggcggcagggacggtggcggcggcgggatgatcgcgtgcacg
cagccgcggcgcgtggcggcagtaacagtagcgcggcgggttgcggaggagatgggggtg
cagctggggcagaaggtcggctactccattcgcttcgacgactgcacttctccctccacg
cgaatcaagtacatgacagatggcatgctgctgagggagtgcctgctggaccccctgctc
aacaaatacaaggtcgtcatcgtggacgaggctcacgagaggaccgtgtcaaccgacgta
ctgctgggcctgctcaagggggtggccgcgcggcgaggggacgacttccggctgttggta
atgagcgccacactcgacgcagaggcgttcagcaagtactttggcggcgcgcgggcggtg
tgggtccaggggcggcagcacccggtggccgtcatgtgcacgactcatccggaggacaat
tacctcgacgcagctttgaacgcggtgctgcaggtgcactgtgaggaggggcccggcgac
atcctcgtgttcttgacgggccaggaggagatcgagggcctggagcggctgctgatggac
cgcgccgcggcgctgccggatggtgccgcggggcgcgggggcggccccgaagagctcttg
gtgctgcccatctacgccgccctgccgccggagcagcagatgcgggtgtttgacccggcg
cccgctggcagccgcaaggcaatcctggcgaccaacattgcggagacgtccatcactatt
ccaggggtgcgctatgtggtggatactgggtttgtcaaggcccgggggtaccacgcaaag
ctgggggcggactcgcttcaggtcgtgccggtctcccaggcgcaggcgcggcagcggagc
ggccgcgcgggccgcgaggggcccggcaaggcgtaccgcctgtacaccctggagtccttc
aaggccctcgcgcccaccacgccgccggagatactgcgcagcaacctcgcgagcacggtg
ctgcagctcaaggccctgggcgtggaggatgtggtgggctttgatttcatggacaagccg
cccagggcggcggtggtcaggcgagcgctcagcgacgtgtgcggtgctttctgcaacggc
ggctcaggcgcagtgatcacggtgccgtttgctccggcccgaccgcctttacctgtgtag

DBGET integrated database retrieval system