KEGG   Methylobacterium nodulans: Mnod_1238Help
Entry
Mnod_1238         CDS       T00839                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
mno  Methylobacterium nodulans
Pathway
mno00350  Tyrosine metabolism
mno00360  Phenylalanine metabolism
mno00380  Tryptophan metabolism
mno01100  Metabolic pathways
mno01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Mnod_1238
   00360 Phenylalanine metabolism
    Mnod_1238
   00380 Tryptophan metabolism
    Mnod_1238
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mno04147]
    Mnod_1238
Enzymes [BR:mno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     Mnod_1238
    4.1.1.105  L-tryptophan decarboxylase
     Mnod_1238
Exosome [BR:mno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mnod_1238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACL56239
UniProt: B8IKN2
Position
1306883..1308343
Genome map
AA seq 486 aa AA seqDB search
MDEDSFRAWAHRAADWSVDYLAGVAERPVRAQVGPGEVFRQIPAAPPAAGEPMEAIFADL
DRLILPGMTHWQHPRFFAYFPANASPPSVVAEFVTAALAAQCMLWQTSPAATELESRVTD
WLRDMIGLGPDFAGVIQDSASGATLAALLTARERALAFAGNREGLAGQRPVRVYASAQVH
SSIDKAVRIAGIGDANLVRIPVTGPLFGMDPAALDAAIRADQAAGLLPAAVVACLGGTSI
GACDPLEAVAAVAARHGVYLHVDAAWAGSAMICPEFRDLMRGAEQADSLVFNPHKWLFTH
FDCSAHFVKDPRALTDTLGLRPPFLRTLEREGVVDYNEWSIPLGRRFRALKLWFVIRSYG
VEGLRDMIRRHVAWARALAERVAAHPDFELVTGPILSLFTFRYAPAGAGDLDALNERLVA
RINDDGRTYLTQTRHDGRFVIRFQIGQTTTTWRDVEIAWEAVQEVAASLAPTRAGSEDGA
GRRDPA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggacagcttccgcgcctgggcgcaccgggcggccgactggtcggtcgactat
ctcgcgggcgtcgccgagcgcccggtgcgggcgcaggtcggccccggcgaggtcttccgg
cagatcccggccgcgccgccggccgcgggcgagccgatggaggcgatcttcgccgatctc
gaccgtctcatcctgccgggcatgacgcattggcagcacccgcgcttcttcgcctatttc
ccggccaatgccagcccgccctcggtggtggcggagttcgtcaccgcggcgctcgcggcg
caatgcatgctctggcagacctcgccggccgcgaccgagctcgagagccgcgtcaccgac
tggctgcgggacatgatcgggctcgggccggacttcgccggcgtgatccaggattccgca
tcgggggcgacgctcgccgccctcctcaccgcccgcgagcgggcgctggccttcgcgggc
aaccgggaaggcttggcggggcagcgacccgtgcgggtctacgcctcggcgcaggtccat
tcctcgatcgacaaggcggtgcggatcgccggcatcggcgacgcgaacctcgtgcgcatc
ccggttaccggcccgctcttcggcatggacccggcggcgctcgacgcggcgatccgcgcc
gaccaggcggccggcctcctgcccgccgccgtggtggcgtgcctgggcggaaccagcatc
ggcgcctgcgatccgctcgaggccgtcgcggcggtcgccgcgcgccacggggtctatctc
catgtcgacgccgcctgggcgggcagcgccatgatctgccccgagttccgcgacctgatg
cggggggcggagcaggccgacagcctcgtgttcaacccgcacaagtggctgttcacgcat
ttcgattgctcggcccatttcgtgaaggatccgcgggcgctgaccgacacgctcggcctg
cgcccgcccttcctgcgcaccctcgagcgcgagggcgtggtcgactacaatgagtggtcg
atccccctcggccggcgcttccgcgccctgaagctgtggttcgtgatccgctcctacggg
gtcgaggggctgcgggacatgatccgccggcacgtggcctgggcgcgggcgctggcggag
cgggtcgcggcgcatcccgacttcgagctcgtgaccgggccgatcctgtcgctcttcacc
ttccggtacgcgccggccggggcgggcgaccttgatgccctcaacgagcgcctcgtcgcg
cggatcaacgacgacgggcgcacctacctcacccagacccgtcacgacggccgcttcgtc
atccgcttccagatcggccagaccacgacgacctggcgggacgtcgagatcgcctgggag
gcggtgcaggaggtcgcggcgtcgctggcgccgacccgcgcggggtcggaggacggggcg
ggacgccgagatcccgcgtga

DBGET integrated database retrieval system