KEGG   Methylobacterium nodulans: Mnod_1533Help
Entry
Mnod_1533         CDS       T00839                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mno  Methylobacterium nodulans
Pathway
mno00900  Terpenoid backbone biosynthesis
mno01100  Metabolic pathways
mno01110  Biosynthesis of secondary metabolites
mno01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mnod_1533
Enzymes [BR:mno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Mnod_1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C Sacchrp_dh_NADP Semialdhyde_dh NmrA
Motif
Other DBs
NCBI-ProteinID: ACL56525
UniProt: B8INJ9
Position
complement(1620869..1622032)
Genome map
AA seq 387 aa AA seqDB search
MTCTVTVLGATGSIGRSTADLLDQHRDRFRVAAVAGGKDAAALARVARELGAGFAALSDP
DGGPALRDALAGSGIACGAGPEAVIEAASRDADLVVAAVSGAAGLTPTHAAIRLGRTVAL
ANKESLVCAGDAFMRDAKRYGARILPMDSEHNALAQAIGEGRIDDITRMTITASGGPFRT
APRERIAAASAAEAAAHPTWSMGMKINIDSATLMNKGLELVEAHHLFSIDAARLDVVVHP
QSIVHGLVTWRDGAVTAGLAMPDMRVPIAHCLGIGDRLSIARGRPVDLAATGSLTFERPD
EERFPCLRIARAALAAGGAQPTVMNAANEIAVAAFIAGRIGFYDIAALVERACEDFAARF
PAAPADVAEALAIDDEVRRWSTRALAA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
ttgacgtgcaccgtcaccgtgctcggagcgaccggctccatcggacgctccaccgccgat
ctcctcgaccagcaccgcgaccgcttccgggtcgcggccgtcgcgggaggcaaggatgcg
gcggcgctggcgcgcgtcgcgcgcgaactcggcgccggcttcgcggccctctccgacccg
gacgggggccctgcgctccgggacgcgctcgcgggcagcggcatcgcctgcggggcgggg
ccggaggcggtgatcgaggcggcgagccgggatgcggacctcgtcgtcgccgccgtgagc
ggggcggcaggtctcacgcccacccacgcagccatccgcctcgggcgcacggtggcgctc
gccaacaaggagagcctcgtctgcgcgggcgacgccttcatgcgcgacgccaagcgctac
ggcgcccgcatcctgccgatggattccgagcacaatgcgctcgcccaggccatcggcgag
ggccgcatcgacgacatcacccgcatgaccatcacggcctcgggggggccgttccgcacg
gcgccgcgcgagcggatcgcggcggcgagcgccgcggaggccgccgcgcacccgacctgg
tcgatggggatgaagatcaacatcgattccgccaccctgatgaacaagggcctcgaactc
gtcgaggcgcaccacctcttctccatcgacgccgcgcggctcgacgtcgtcgtgcacccg
caatcgatcgtccacggcctcgtgacctggcgcgacggagcggtgacggccgggctcgcc
atgccggacatgcgggttccgatcgcccattgcctcggcatcggcgatcggctgtccatc
gcgcggggccgcccggtcgacctcgcggcgaccggcagcctcaccttcgagcgcccggac
gaggagcgcttcccgtgcctgcgcatcgccagggcggcgctcgcggcgggcggcgcgcag
cccaccgtgatgaacgcggccaacgagatcgcggtcgccgccttcatcgccgggcggatc
ggcttctacgacatcgccgccctggtcgagcgggcctgcgaggatttcgctgcgcgcttc
cccgcggcgcccgccgacgtggccgaggcgctggccatcgacgacgaggtgcggcgctgg
agcacacgggcgctcgcggcctag

DBGET integrated database retrieval system