KEGG   Methylobacterium nodulans: Mnod_1913Help
Entry
Mnod_1913         CDS       T00839                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mno  Methylobacterium nodulans
Pathway
mno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Mnod_1913
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mno03011]
    Mnod_1913
Ribosome [BR:mno03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Mnod_1913
  Bacteria
    Mnod_1913
  Archaea
    Mnod_1913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ACL56902
UniProt: B8IS90
Position
2017239..2017622
Genome map
AA seq 127 aa AA seqDB search
MGKAAAPRALPENEAKAVARMLRVSPQKLNLVAQLIRGKKVATALADLQFSQKRIAVEVK
KCLESAIANAENNHDLDVDDLVVKEAYVGKALVLKRFHARARGRGARILKPFSNLTIVVR
EVRAEAA
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggcagcagcaccccgcgcgctccccgagaacgaggcgaaggctgtcgcgcgc
atgctgcgcgtcagcccgcagaagctcaacctcgtcgcgcagctgatccggggcaagaag
gtcgcgaccgcgctcgccgacctgcagttctcgcagaagcgcatcgccgtcgaggtcaag
aagtgcctcgagagcgcgatcgccaacgccgagaacaaccacgacctcgatgtcgacgac
ctcgtggtcaaggaggcctatgtgggcaaggcgctcgtgctgaagcgcttccatgcccgc
gcccgcggccggggtgcccgcatcctgaagccgttctcgaacctcaccatcgtggtgcgt
gaggtccgggccgaggccgcgtga

DBGET integrated database retrieval system