KEGG   Methylobacterium nodulans: Mnod_2680Help
Entry
Mnod_2680         CDS       T00839                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mno  Methylobacterium nodulans
Pathway
mno00010  Glycolysis / Gluconeogenesis
mno00260  Glycine, serine and threonine metabolism
mno00680  Methane metabolism
mno01100  Metabolic pathways
mno01110  Biosynthesis of secondary metabolites
mno01120  Microbial metabolism in diverse environments
mno01130  Biosynthesis of antibiotics
mno01200  Carbon metabolism
mno01230  Biosynthesis of amino acids
Module
mno_M00002  Glycolysis, core module involving three-carbon compounds
mno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mnod_2680
  Energy metabolism
   00680 Methane metabolism
    Mnod_2680
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mnod_2680
Enzymes [BR:mno01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mnod_2680
Membrane trafficking [BR:mno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Mnod_2680
Exosome [BR:mno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mnod_2680
  Exosomal proteins of melanoma cells
   Mnod_2680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACL57642
UniProt: B8IE96
Position
complement(2752660..2753301)
Genome map
AA seq 213 aa AA seqDB search
MDIGKQMLVLMRHGQSLDNEQDLFSGWRNPALTARGVAEAHAAGRKLKELGFSFNLAFTS
KLRRAQHTLALMLEELGQPTLPVHADTALNERDYGALSGLNKTGARSLWGAEQVHLWRKS
YDAVPPGGESLAMTAARVVPFYEREIAPCARAGKRVLVVAHGNSLRSLVMHLDGLDPEEI
VGVNIATSEILIYCLNKRGHIASKTAMPASSIA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggatataggcaagcagatgctcgtgctgatgcgccatgggcagagcctggacaacgaa
caggacctgttctcagggtggcgcaacccggccttgactgcccgcggtgttgccgaggct
cacgcagctgggcgcaagctgaaagaactcggcttttccttcaatcttgcattcaccagc
aagctcaggcgcgctcagcacacgctggccctcatgcttgaggaactcggccagcccacc
ctccccgtgcatgcagacacggctctgaacgagcgtgactacggcgcgctcagcggcttg
aacaagacgggcgctcgttcgctctggggtgcggagcaggtccatctctggcgcaagtcc
tacgacgcagtgccaccgggtggcgagagtttggcaatgacggctgcgcgcgtcgtgccc
ttctacgaacgcgagatcgcgccttgcgcccgagcgggcaagcgggtgcttgtggtcgcg
cacggtaacagcctgcgttctctggttatgcatctggatggactcgatcctgaagagata
gtcggggtgaacatcgctacgagcgagatcctgatttactgcttgaataagcggggccat
atcgccagtaaaacagccatgcctgcatcatccattgcttag

DBGET integrated database retrieval system