KEGG   Methylobacterium nodulans: Mnod_2781Help
Entry
Mnod_2781         CDS       T00839                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mno  Methylobacterium nodulans
Pathway
mno00230  Purine metabolism
mno01100  Metabolic pathways
Module
mno_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mnod_2781
Enzymes [BR:mno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Mnod_2781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 AAA_22 TsaE AAA_25 AAA_30 AAA AAA_28 ABC_tran cobW CbiA CPT AAA_29 RRF RsgA_GTPase Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: ACL57733
UniProt: B8IFJ8
Position
complement(2861934..2862593)
Genome map
AA seq 219 aa AA seqDB search
MAIGSETRVSRRGLVLILSSPSGAGKTTLTRALAQQPEWGLELSVSVTTRARRPSEIDGQ
HYRFIDRETFDALRERDDMLEWAEVHGNFYGTPCRPVERALAAGRDMIFDIDYQGTRQVR
AKLRDDVVTIFILPPSMAELRRRLERRAEDSAETIERRLRNARTEIERWSEYDYVLINDD
LDRSFKTLEAILTAERLRRQRQVGLDSFVAGLLAEAPAG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcgatagggtccgaaacacgggtgtcgcggcgcggtctggtgctgatcctctcctcg
ccctcgggcgcaggcaagacgacgctgacccgtgcgctcgcccagcagcccgaatgggga
ctggaattgtcggtctcggtcacgacccgggcgcggcgcccttccgagatcgacggccag
cattaccgtttcatcgaccgcgagaccttcgacgccctgcgcgagcgcgacgacatgctc
gaatgggcggaggtgcacggcaacttctacggcacgccgtgccgcccggtggagcgggcg
ctggcggcgggccgcgacatgatcttcgacatcgactatcagggcacgcggcaggtgcgc
gccaagctgcgcgacgacgtggtgacgatcttcatcctgccgccgagcatggcggagctg
cgccgccgcctggagcgccgggccgaggattcggccgagaccatcgagcgtcgcctgcgc
aacgcgcggaccgagatcgagcgctggtcggaatacgactacgttctcatcaacgacgat
ctcgaccgctccttcaagacgctcgaagcgatcctcaccgccgagcgcctgcgccgccag
cggcaggtgggactcgacagcttcgtggccgggctcctcgccgaggcgcccgccggctga

DBGET integrated database retrieval system