KEGG   Methylobacterium nodulans: Mnod_2910Help
Entry
Mnod_2910         CDS       T00839                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
mno  Methylobacterium nodulans
Pathway
mno00361  Chlorocyclohexane and chlorobenzene degradation
mno00625  Chloroalkane and chloroalkene degradation
mno01100  Metabolic pathways
mno01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mno00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mnod_2910
   00361 Chlorocyclohexane and chlorobenzene degradation
    Mnod_2910
Enzymes [BR:mno01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Mnod_2910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: ACL57861
UniProt: B8IGY6
Position
complement(3002651..3003319)
Genome map
AA seq 222 aa AA seqDB search
MSAFRPKYITFDCYGTLTNFQMAEAARSIYGVTLEAPRMTEFIRNFAAYRLDEILGDWKP
YDEVIHNAVERTCRKTGVTFRPEDARAIYERVPTWGPHPDVPAGLAKVAREIPLVILSNA
MDAQIPSNVAKLGAPFHAVYTAQQAGAYKPRLRAFEYMFDRLGCGPEDVMHCSSSFRYDL
MSAHDLGIRHKVWVNRGHEPANPYYGYVEIRDISGLPGIVGL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgtttcggcccaaatacatcaccttcgattgctacggcacgttgacgaacttc
cagatggccgaggcggcgcggagcatctacggcgtcacgctcgaggccccccgcatgacg
gagttcatcaggaactttgcggcctaccggctcgacgagatcctcggcgactggaagccg
tacgacgaggtgatccacaacgccgtggagcgcacctgccgcaagaccggtgtcaccttc
cgcccggaggacgcgcgcgccatctacgagcgggtgccgacctgggggccgcatccggac
gtgcccgcgggcctcgccaaggtcgcccgggagatcccgctggtgatcctgtccaacgcc
atggacgcgcagattccctccaacgtcgccaagctcggcgcgcccttccacgcggtctac
acggcgcagcaggccggggcctacaagccgcgcttgcgcgccttcgagtacatgttcgat
aggctcggctgcggaccggaggacgtgatgcactgctcgtcctccttccgctacgacctg
atgtccgcccacgatctcggcatccggcacaaggtctgggtgaatcgcgggcacgagccg
gcaaacccctattacggctatgtcgagatcagggacatctccggcctgcccggcatcgtc
gggctctaa

DBGET integrated database retrieval system