KEGG   Methylobacterium nodulans: Mnod_3038
Entry
Mnod_3038         CDS       T00839                                 

Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
mno  Methylobacterium nodulans
Brite
KEGG Orthology (KO) [BR:mno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mno02044]
    Mnod_3038
Secretion system [BR:mno02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mnod_3038
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ACL57979
UniProt: B8IIB0
Position
complement(3129943..3131886)
AA seq 647 aa
MNREFLDLYNRELGVLNEDARAFAQEYPGIAERLGGLVEDRADPMIAGLLEGAAFLAARV
QLKLKHEFPEFTASLLEQLVPHYLAPTPSVLLARIGAPYGDPALRAGRRIARGAILDAAY
SERERRVACRYRLTRDVVLWPFAITAAEYCATPAGLSALGLPVEADVAAGLRLTLTHRTA
ADPAQEEGADPEAASIAGCAVDDLPVHLVGPEADAVAIYEALFSASARVAFRVLDAFGDP
VVVPAPPGCLAPVGFEREEALLPNDLRVFEGFDLLREYFMFPRKFLGFRLTGLREVLPRL
TARSVDVIVTFRECNARLAAAVRPEAFALYAAPAVNLFEMTTDRVPVRAGEHEHHLVPDR
SRMLDFEPHRVLDVYAHVAGRSEKRRVEPLHAAQGAARATGPSYTLRRLPRRRSSAERQA
AQTSDYCGTEIFLTLVDSAREDEERIAELSVRALCSNRHLPEHLPVGAGGTDFRLADDAD
LEVLCVAGPTRPREPVVAQMRGRAGTAWTGEVAWRLVNMLSLNHLGLVRRGAGASAEALR
EMLSLFADLSDAAVERRIRGVRSVDSRPVVRRLRQRLGTGTARGTEVTVTLDERAFEGTG
AFLLGAVLDRFYAEYAGINHFTQTVIRTTDRGEIMRWPPRAGARAPL
NT seq 1944 nt   +upstreamnt  +downstreamnt
atgaaccgggaattcctcgacctctacaaccgcgaactcggcgtcctgaacgaggacgcg
cgtgccttcgcgcaggaatatccgggcatcgcggaacgcctcggcggcctcgtcgaggac
cgcgccgacccgatgatcgccggcctcctcgaaggcgcggcgttcctggccgcgcgcgtg
cagctcaagctcaagcacgaattccccgaattcaccgcgagcctgctcgaacagctcgtg
ccgcactacctcgcgccgacgccctcggtgctgctcgcccgaatcggggcgccctacggc
gacccggccctgcgcgccgggcgccggatcgcccgcggggcgatcctggatgccgcctac
agcgagcgcgagcgccgggtcgcctgccgctaccgcctgacgcgcgacgtggtgctgtgg
cccttcgcgatcaccgccgcggagtactgcgcgaccccggcgggcttgagcgcgctcggc
ctcccggtcgaggcggacgtcgcggcgggcctgcgcctgacgctgacgcaccgcaccgcc
gccgatccggcgcaggaggagggcgcggacccggaggccgcctcgatcgcggggtgcgcc
gtcgacgacctgccggtccacctcgtcggcccggaggcggacgcggtcgcgatctacgag
gcgctgttctcggcctccgcgcgcgtcgccttccgggtgctcgacgccttcggggacccg
gtcgtggtgccggcgccgcccggctgcctcgcgccagtcggcttcgagcgcgaggaggcg
ctgctgccgaacgacctgcgggtcttcgagggctttgatctcctgcgcgagtacttcatg
ttcccgcgcaagttcctgggcttccgcctcaccggcctgcgcgaggtgctgccgcggctc
acggcgcgcagcgtcgacgtgatcgtgaccttccgggagtgcaatgcccgcctcgccgcg
gccgtgcggccggaggccttcgcgctctatgcggcgccggccgtcaacctgttcgagatg
acgacggaccgcgtgccggtgcgggccggcgagcacgagcaccacctcgtgcccgaccgc
agccgcatgctcgacttcgagccgcaccgcgtgctcgacgtctacgcccacgtcgcgggc
cggtccgagaagcgccgggtcgagccgctgcacgcggcgcagggcgccgcgcgggcgacg
ggcccatcctatactctacgccgcctgccgcgccgccgctcgtcggcagagcggcaggcg
gcgcagacctcggattactgcgggaccgagatcttcctcaccctcgtcgactcggcgcgc
gaggacgaggagcgcatcgccgaactcagcgtgcgggcgctctgctcgaaccggcacctg
cccgagcacctgccggtcggggcgggcggcaccgacttccgcctcgcggacgacgccgac
ctggaggtgctgtgcgtcgccggcccgacgcgcccgcgcgagcccgtggtggcgcagatg
cgcggccgggccgggaccgcctggaccggcgaggtggcgtggcgcctcgtgaacatgctg
agcctcaaccacctcgggctggtgcgccgcggggcgggggcgagcgccgaggcgctgcgg
gagatgctgtcgctcttcgccgacctctccgacgcggcggtggagcgccgcatccgcggc
gtgcgcagcgtcgacagccgcccggtggtgcggcggctgcgccagcgcctcggcaccggc
acggcgcgcggcaccgaagtgaccgtcactctcgacgagcgcgccttcgagggcaccggc
gccttcctgctcggcgccgtgctcgaccgcttctacgccgaatatgccgggatcaaccac
ttcacccagaccgtgatccgcacgacggaccgcggcgagatcatgcgctggccgccccgg
gccggcgcgagggcgccgctgtga

DBGET integrated database retrieval system