KEGG   Methylobacterium nodulans: Mnod_4591Help
Entry
Mnod_4591         CDS       T00839                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mno  Methylobacterium nodulans
Pathway
mno00072  Synthesis and degradation of ketone bodies
mno00650  Butanoate metabolism
mno01100  Metabolic pathways
Module
mno_M00088  Ketone body biosynthesis, acetyl-CoA => acetoacetate/3-hydroxybutyrate/acetone
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Mnod_4591
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Mnod_4591
Enzymes [BR:mno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Mnod_4591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 Flagellar_rod
Motif
Other DBs
NCBI-ProteinID: ACL59458
UniProt: B8ID66
Position
complement(4651619..4652404)
Genome map
AA seq 261 aa AA seqDB search
MTLTSKTAVVTGSTSGIGLAIARGLAKDGANIVLNGFGQPEDIERERAAIEAEFGVKARY
SGADMSKPDEIAGMIAEAETAFGAVDVLVNNAGIQFVSPIEEFPVGKWDQIIAINLSSAF
HAMRAAIPGMKRQGWGRIINTASAHSLVASPFKAAYVAAKHGIAGLTKTAALELATHKIT
VNCISPGYVWTPLVESQIPDTMKARGLTKEQVINDVLLQAQPTKEFVTVDQVAAIAVFLC
SDAASQITGANISVDGGWTAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgacatcgaagaccgccgtcgtcaccggctcgacgagcggcatcggcctcgcc
atcgcgcggggcctcgccaaggacggggccaacatcgtcctcaacggcttcggccaacct
gaggacatcgagcgcgagcgcgcggcgatcgaagccgagttcggtgtgaaggcccgctac
tcgggcgccgacatgtcgaagcccgacgagatcgccgggatgatcgcggaggccgagacg
gccttcggcgcggtggacgtgctggtcaacaatgcgggcatccagttcgtctcgccgatc
gaggaattcccggtcggcaagtgggaccagatcatcgccatcaacctgtcctcggccttc
cacgcgatgcgggcggcgatccccggcatgaagcgccagggctggggccggatcatcaac
accgcctcggcgcattcgctggtggcctcgcccttcaaggcggcctatgtggcggccaag
cacggcattgccggcctgaccaagacggcggcgctggaactggccacccacaagatcacg
gtgaactgcatctcgccgggctatgtctggacgccgctggtggagagccagatccccgac
acgatgaaggcgcgcggcctcaccaaggagcaggtcatcaacgacgtgctgctgcaggcg
cagcccacgaaggaattcgtcacggtggatcaggtcgcggcgatcgccgtgttcctgtgc
tcggacgcggcgagccagatcaccggcgccaacatctccgtcgacggcggctggacggcg
caatag

DBGET integrated database retrieval system