KEGG   Methylobacterium nodulans: Mnod_4781Help
Entry
Mnod_4781         CDS       T00839                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mno  Methylobacterium nodulans
Pathway
mno00071  Fatty acid degradation
mno00072  Synthesis and degradation of ketone bodies
mno00280  Valine, leucine and isoleucine degradation
mno00310  Lysine degradation
mno00362  Benzoate degradation
mno00380  Tryptophan metabolism
mno00620  Pyruvate metabolism
mno00630  Glyoxylate and dicarboxylate metabolism
mno00640  Propanoate metabolism
mno00650  Butanoate metabolism
mno00900  Terpenoid backbone biosynthesis
mno01100  Metabolic pathways
mno01110  Biosynthesis of secondary metabolites
mno01120  Microbial metabolism in diverse environments
mno01130  Biosynthesis of antibiotics
mno01200  Carbon metabolism
mno01212  Fatty acid metabolism
mno02020  Two-component system
Module
mno_M00088  Ketone body biosynthesis, acetyl-CoA => acetoacetate/3-hydroxybutyrate/acetone
Brite
KEGG Orthology (KO) [BR:mno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mnod_4781
   00630 Glyoxylate and dicarboxylate metabolism
    Mnod_4781
   00640 Propanoate metabolism
    Mnod_4781
   00650 Butanoate metabolism
    Mnod_4781
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mnod_4781
   00072 Synthesis and degradation of ketone bodies
    Mnod_4781
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mnod_4781
   00310 Lysine degradation
    Mnod_4781
   00380 Tryptophan metabolism
    Mnod_4781
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mnod_4781
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mnod_4781
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mnod_4781
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mno04147]
    Mnod_4781
Enzymes [BR:mno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mnod_4781
Exosome [BR:mno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mnod_4781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACL59645
UniProt: B8IFT5
Position
complement(4862007..4863188)
Genome map
AA seq 393 aa AA seqDB search
MAEKQDIVIVGAARTPVGSFNGAFATLPAHELGAVAIRAALERAKVAPAEVDEVIFGQVL
TAGAGQNPARQAAIAAGIPQEATAWGLNQLCGSGLRTVAIGMQQIANGDAKIIVAGGQES
MSMAPHAQHLRGGQKMGDLALIDTMLKDGLMDAFNGYHMGNTAENIAQKWQLTREEQDAF
ATRSQNKAEAARKAGRFKAEIVPVPVKTRKGEVVVEADEYIREGATVEAMAKLRPAFAKE
GTVTAGNASGINDGAAALVLMAAAEAERRGLTPLARIVSWATAGVDPKIMGTGPIPASRK
ALEKAGWSAAEIDLIEANEAFAAQALAVNKELGFDDAKVNVNGGAIAIGHPIGASGARVL
VTLLHEMQRRDAKKGLATLCIGGGMGVAMCVER
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagcaggacatcgtcatcgtgggtgcggcgcggacgccggtcggctcgttc
aacggcgcctttgcgaccctgccggcccacgagctcggggcggtggcgatccgggcggcg
ctggagcgggccaaggtggcgccggcggaggtggacgaggtgatcttcggccaggtgctg
accgccggggcgggccagaacccggcccgccaggcggcgatagcggccgggatcccgcag
gaggcgaccgcctggggcctcaaccagctctgcggctcgggcctgcgcacggtggcgatc
ggcatgcagcagatcgccaacggcgacgccaagatcatcgtggcgggcggccaggaatcg
atgtcgatggcgccgcatgcccagcatctgcgcggcggccagaagatgggcgacctggcc
ctgatcgacacgatgctgaaggacggcctgatggacgccttcaacggctaccacatgggc
aacacggccgagaacatcgcccagaagtggcagctcacgcgcgaggagcaggacgcgttt
gcgacccgctcgcagaacaaggccgaggcggcccgcaaggcgggccggttcaaggccgag
atcgtgccggtcccggtcaagacccgcaagggcgaggtggtggtcgaggccgacgagtac
atccgggagggggcgaccgtggaggcgatggccaagctgcggccggccttcgcgaaggag
ggcacggtcacggccggcaacgcctcggggatcaacgacggggcggccgcgctggtgctg
atggcggcggcggaggccgagcggcgcggcctgaccccgctggcgcggatcgtctcctgg
gcgaccgcgggggtggacccgaagatcatgggcaccggcccgatcccggcctcgcgcaag
gcgctggagaaggccggctggagcgcggcggagatcgacctgatcgaggccaacgaggcc
tttgcggctcaggcgctggcggtgaacaaggagctgggcttcgacgacgccaaggtcaac
gtgaacggcggcgccattgcgatcgggcatccgatcggcgcctcgggcgcccgggtgctg
gtgacgctgctgcacgagatgcagcgccgcgacgccaagaaggggctggccaccctctgc
atcggcggcggcatgggcgtcgccatgtgcgtggaacgctga

DBGET integrated database retrieval system