KEGG   Methylobacterium nodulans: Mnod_5443Help
Entry
Mnod_5443         CDS       T00839                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mno  Methylobacterium nodulans
Pathway
mno00071  Fatty acid degradation
mno00072  Synthesis and degradation of ketone bodies
mno00280  Valine, leucine and isoleucine degradation
mno00310  Lysine degradation
mno00362  Benzoate degradation
mno00380  Tryptophan metabolism
mno00620  Pyruvate metabolism
mno00630  Glyoxylate and dicarboxylate metabolism
mno00640  Propanoate metabolism
mno00650  Butanoate metabolism
mno00900  Terpenoid backbone biosynthesis
mno01100  Metabolic pathways
mno01110  Biosynthesis of secondary metabolites
mno01120  Microbial metabolism in diverse environments
mno01130  Biosynthesis of antibiotics
mno01200  Carbon metabolism
mno01212  Fatty acid metabolism
mno02020  Two-component system
Module
mno_M00088  Ketone body biosynthesis, acetyl-CoA => acetoacetate/3-hydroxybutyrate/acetone
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mnod_5443
   00630 Glyoxylate and dicarboxylate metabolism
    Mnod_5443
   00640 Propanoate metabolism
    Mnod_5443
   00650 Butanoate metabolism
    Mnod_5443
  Lipid metabolism
   00071 Fatty acid degradation
    Mnod_5443
   00072 Synthesis and degradation of ketone bodies
    Mnod_5443
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mnod_5443
   00310 Lysine degradation
    Mnod_5443
   00380 Tryptophan metabolism
    Mnod_5443
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mnod_5443
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mnod_5443
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mnod_5443
Enzymes [BR:mno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mnod_5443
Exosome [BR:mno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mnod_5443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ACL60287
UniProt: B8IMU4
Position
complement(5535879..5537081)
Genome map
AA seq 400 aa AA seqDB search
MREAVIVATARTPIGKAYRGAFNDTQAQALGGHVIAEAVKRAGIDPAEVGDVVMGAALQQ
GSTGSNVARQSALRAGLPASVAGMSVDRQCASGLMAIATAAKEIVADGLAVAVGGGLESI
SLVQNDKMNRFRGADPWLVEHVPALYMTMIETAETVAERYRISREAQDEYALGSQRRTAA
AQEAGRFAEEIISVTTRMIVTDKVTGETSPREITLSQDEGNRPQTRLEDLAALKPVFKDG
QRIGQGRFVTAGNASQLSDGAAACVLMEAREAERRGLQPLGAYRGMAVAGCEPDEMGIGP
VFAVPKLLRQHGLSVEDIDLWELNEAFACQVLYCRDRLGIPDERLNVDGGAISIGHPYGM
SGARMTGHILLEGRRRGAKYGVVTMCVGGGMGAAGLFEIY
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaagccgtcatcgtcgccaccgcgcgcacgcccatcggcaaggcctatcggggc
gccttcaacgatacccaggcacaggccctcggcggccatgtcatcgccgaggccgtgaag
cgcgccggcatcgacccggccgaggtcggcgacgtggtgatgggggcggccctccagcag
ggctcgaccgggtcgaacgtggcgcgccagtcggcgctgcgggcgggcctgccggcgagc
gtggcgggtatgagcgtcgaccgccaatgcgcctcgggtctgatggcgatcgccaccgcc
gctaaggagatcgtggcggacgggctcgccgtcgcggtgggcggcggcctggaatcgatc
tcgctcgtgcagaacgacaagatgaaccggttccgcggggcggatccctggctcgtggag
cacgtgcccgcgctctacatgaccatgatcgagaccgccgagacggtggcggagcgctat
cgtatcagccgcgaggcgcaggacgaatacgcgctcggctcccagaggcgcaccgcggcg
gcgcaggaagcgggccgcttcgccgaggagatcatttcggtcaccacccgcatgattgtc
accgacaaggtgaccggagagacctccccgcgggagatcaccctgtcgcaggacgagggc
aaccggccccagacgcggctggaggatctcgcggccctcaagccggtgttcaaggacggc
cagcggatcgggcagggccgcttcgtcaccgccggcaatgcgagccagctctcggacggt
gccgcagcctgcgtgctgatggaggcgcgtgaggcggagcggcgcggcctgcagccgctc
ggcgcctatcggggcatggcggtggccggctgcgagcccgacgagatgggcatcggcccg
gtcttcgcggtgcccaagctcctgcggcagcacggtctctcggtcgaggacatcgacctc
tgggagctcaacgaggccttcgcctgccaggtgctctattgccgcgaccggctcggcatc
ccggacgagcggctgaacgtcgatggcggcgccatcagcatcgggcatccctacggcatg
tcgggggcccgcatgaccgggcacatcctgctggaaggccgccgccgcggcgccaagtac
ggggtcgtcacgatgtgcgtgggcggcggcatgggcgccgccggcctcttcgagatctac
tga

DBGET integrated database retrieval system