KEGG   Methylobacterium nodulans: Mnod_5857Help
Entry
Mnod_5857         CDS       T00839                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mno  Methylobacterium nodulans
Brite
Enzymes [BR:mno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mnod_5857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 GCD14 RrnaAD
Motif
Other DBs
NCBI-ProteinID: ACL60685
UniProt: B8ISN6
Position
complement(5963552..5964451)
Genome map
AA seq 299 aa AA seqDB search
MADVSRRRAAYEVPAMADVSRRRAAYASLVAARAKTRDPALIRAFATVPREAFCGPGPWQ
VMGEAGPEIVPADDPGGLYRDVLVALLPGEGINNGEPSLHALALAAAALRPGERVVQVGV
GGGYYTAILAELVGPEGRVDAFEVEPTLAAQAAAALAGYPQVVVHSRSGAEGPLPEADFV
SVNAGATAPLALWLDALSPTGRLIVPLTPDRGWGGLLLARRRGPGRPADILEARFLARTL
FVPCLGARSREGAARLGMAFAADGMDKVRSLRRGSAPDGSAWLAGEGWWLSRRRADATA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgtgagccgccgccgcgctgcctatgaggtccctgcgatggccgatgtgagc
cgccgccgcgctgcctatgccagcctcgtggcagcccgggcgaagacgcgcgaccccgcc
ctcatccgtgcgttcgcgaccgtgccgcgggaggccttctgcgggcccggcccctggcag
gtgatgggcgaggccggccccgagatcgtcccggccgacgatcccggcgggctctaccgg
gacgtcctcgtggcgctcctgcccggggaggggatcaacaacggcgagccgagcctgcac
gcgctggccctcgccgcggcggccctgcggccgggcgagcgggtggtgcaggtcggcgtc
ggtggcggctactacacggcgatcctcgccgaactcgtcggcccggagggccgggtcgat
gcctttgaggtcgagccgacgctggcggcgcaggcggcggcggcgctggccggctacccg
caggtcgtcgtccattcccgctcgggtgcggagggccctctgccggaggccgatttcgtc
tctgtgaatgcgggcgcgaccgctccgctcgccctgtggctcgacgccctgtcgccgacc
ggccgcctgatcgttccgctgacgccggaccgaggctggggcggcctgctgctggcgcgc
cgccgcggccccggccgcccggccgacatcctcgaggcgcgctttctcgcccggacgctc
ttcgtcccctgcctcggcgcgcgcagtcgcgagggcgcggcgcggctcggcatggccttc
gcggcagacgggatggacaaggtgcgcagcctgcgccgcggctcggcgccggacgggagc
gcctggctggcaggggagggatggtggctgtcgcggcggcgggccgacgcgacggcctga

DBGET integrated database retrieval system