KEGG   Methylobacterium nodulans: Mnod_7178Help
Entry
Mnod_7178         CDS       T00839                                 

Definition
(GenBank) HpcH/HpaI aldolase
  KO
K08691  malyl-CoA/(S)-citramalyl-CoA lyase [EC:4.1.3.24 4.1.3.25]
Organism
mno  Methylobacterium nodulans
Pathway
mno00630  Glyoxylate and dicarboxylate metabolism
mno00660  C5-Branched dibasic acid metabolism
mno00680  Methane metabolism
mno01100  Metabolic pathways
mno01120  Microbial metabolism in diverse environments
mno01200  Carbon metabolism
Module
mno_M00346  Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:mno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mnod_7178
   00660 C5-Branched dibasic acid metabolism
    Mnod_7178
  09102 Energy metabolism
   00680 Methane metabolism
    Mnod_7178
Enzymes [BR:mno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     Mnod_7178
    4.1.3.25  (S)-citramalyl-CoA lyase
     Mnod_7178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI C-C_Bond_Lyase
Motif
Other DBs
NCBI-ProteinID: ACL61918
UniProt: B8IKD3
Position
7262688..7263740
Genome map
AA seq 350 aa AA seqDB search
MKLPRRFFQPLATGAPAPFRELPVRLERMIHFVPPHNEKVRARVPELATQVDVVLGNLED
AVPADQKLAARKGFIAMAQATDFAAAGTGLWTRINALNSPWILDDLFEIVTEVGNRLDVV
MVPKVEGPWDIHYIDQLLAQLEARAGVTKPILVHAILETAEGVANVDAIASASPRMHGMS
LGPADLAASRGMKTTRVGGGHPDYRVIADPVEGVAERASVQQDLWHYTIAKMVDACQANG
IKAFYGPFGDFSDSAACEAQFRNAFLMGCAGAWTLHPSQVAIAKKVFAPDPAEVAFAKRI
LEAMPDGTGAVMLDGKMQDDATWKQASVIVNLAKLVASKDPDLARTYGLG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccgcgccgcttcttccagccgctcgccaccggtgcgcccgcgccgttccgc
gagctgccggtgcgcctggagcgcatgatccacttcgtgcccccgcacaatgagaaggtg
cgcgcccgggtgccggagctcgccacccaggtcgacgtggtgctgggcaacctggaggat
gcggttccggccgaccagaagctcgccgcccgcaagggcttcatcgccatggcgcaggcg
accgacttcgccgccgccggcaccggcctgtggacgcgcatcaatgcgctcaacagcccc
tggatcctcgacgacctgttcgagatcgtcaccgaggtcggcaaccggctcgacgtggtg
atggtgcccaaggtcgaggggccgtgggacatccactacatcgaccagctcctcgcccag
ctcgaagcccgggccggggtgacgaagccgatcctcgtccatgcgatcctggagaccgcc
gagggcgtggcgaatgtggacgccatcgcgagcgcctccccgcgcatgcacggcatgagc
ctcggcccggcggatctcgcggcctcccgcggcatgaagacgacccgggtcggcggcggc
catccggactaccgggtcatcgccgatccggtcgagggcgtggccgagcgcgcgagcgtg
cagcaggacctctggcactacaccatcgccaagatggtcgatgcctgccaggcgaacggc
atcaaggccttctacggcccgttcggcgacttctccgacagcgccgcctgcgaggcgcag
ttccgcaacgccttcctgatgggctgcgcgggcgcctggacgctgcatccgagccaagtc
gccatcgccaagaaggtcttcgcgcccgatccggccgaggtcgccttcgccaagcggatc
ctggaggcgatgccggacggcaccggcgcggtcatgctcgacggcaagatgcaggacgac
gccacctggaaacaggcgagcgtgatcgtgaacctcgccaagctcgtcgccagcaaggat
cccgacctcgcccggacctacggcttgggctga

DBGET integrated database retrieval system