KEGG   Methylobacterium nodulans: Mnod_7451Help
Entry
Mnod_7451         CDS       T00839                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
mno  Methylobacterium nodulans
Brite
KEGG Orthology (KO) [BR:mno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Mnod_7451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ACL62188
UniProt: B8IN72
Position
7542866..7543258
Genome map
AA seq 130 aa AA seqDB search
MYKAETRGISVIVTPRFVEEESSPDESRYFFAYTVEITNNGRDRVQLRSRHWRIIDGRGA
LQEVRGAGVVGKQPVLGPGESFSYTSGCPLPTPNGTMEGTYTMATADGESFEAVIPAFSL
DVPHMRRVMH
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggccgagacccgcggcatcagcgtgatcgtcacgccccggttcgtggaggag
gaatcctcgccggacgagagccgctacttcttcgcctatacggtcgagatcaccaacaac
gggcgcgacagggtgcaactgcgctcgcggcactggcgcatcatcgacggccggggcgcc
ctgcaggaggtgcgcggcgcgggcgtcgtcggcaagcagcccgtgctggggcccggcgag
tcgttcagctacaccagcggctgcccgctgccgacgccgaacggcaccatggagggcact
tacacgatggcgaccgcggacggcgaaagcttcgaggcggtgatccccgccttctccctc
gacgtgccccatatgcgccgggtcatgcactga

DBGET integrated database retrieval system