KEGG   Massilia sp. NR 4-1: ACZ75_01400Help
Entry
ACZ75_01400       CDS       T04026                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mnr  Massilia sp. NR 4-1
Pathway
mnr00450  Selenocompound metabolism
mnr00970  Aminoacyl-tRNA biosynthesis
mnr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mnr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ACZ75_01400
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ACZ75_01400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mnr01007]
    ACZ75_01400
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mnr03016]
    ACZ75_01400
Enzymes [BR:mnr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ACZ75_01400
Amino acid related enzymes [BR:mnr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ACZ75_01400
Transfer RNA biogenesis [BR:mnr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ACZ75_01400
 Prokaryotic type
   Other AARSs
    ACZ75_01400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind Anticodon_1 tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AKU20386
UniProt: A0A0K1JTT1
Position
complement(345673..347799)
Genome map
AA seq 708 aa AA seqDB search
MTRKLFVTTALPYANAAFHIGHMMEYIQADIWVRFQRMQSEGNGLREVHFVGADDTHGTP
IMIAAEKEGITPQEFVAKIAAGRAQYLDGFHIAFDNWYSTDSPENVELSQGIYRKLRDAG
LIQTKTVDRFYDPVKGMFLADRNIKGECPKCHAKDQYGDNCEVCGAAYQPTELVNPFSVF
TNATPILKPSEQYFFKLSDPRCFEFLRDWLNTPGRLQPEMVNKVSEWLGEAGEKLADWDI
SRDAPYFGIPIPDAPGKFFYVWLDAPVGYLASLKNYCEKQGMDFNALLNDPATEQIHFIG
KDIVSFHLLFWPAMLKFADHPVIEKLKVNVHGHLTVNNEKMSKSRGTGISPLRYLNLGMN
PEWLRYYIAFKLNSKVEDLDFTGDDFVARVNSDLIGKFVNIASRCAGFIAKKFDGKLASE
LSPSAQDWIKRALLSAEGKERQASIAHNFENREFGKALREIMEIADAANQYVDENKPWVL
AKDAEKTAELHEVCTTALILFRQLAILLSPVLPGVAANVRKFLKDERMVWADTEVASGAV
YKTMLGRTIGAYEHLMTRVDAKMIEDLFDAPAQQAAAAPAAAEAAAAATGIEELAPEIKI
DDFAKIDLRVAKIVNCEHVEGSDKLLRLTLDVGEGRHRNVFSGIKAAYKPEDLIGKLTVM
VANLAPRKMKFGISEGMVLAASAADEKANPGLYILNPWPGAEPGMRIG
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaagctgttcgtcactactgccctgccctacgcaaacgctgccttccacatc
ggccatatgatggaatacatccaggccgacatctgggttcgtttccagcgaatgcagagc
gaaggcaacggcctgcgcgaagtgcatttcgtcggcgccgacgatacccacggcacgccg
atcatgatcgcggccgaaaaggaaggcatcacgccccaggaattcgtggccaagatcgcg
gccggccgcgcccagtacctggacggcttccacatcgccttcgataactggtattccacc
gattcgccggaaaacgtcgagctgtcccagggcatctaccgcaagctgcgcgacgccggc
ctgatccagaccaagaccgtcgaccgcttctacgatccggtcaaaggcatgttcctggcc
gaccgcaatatcaagggcgagtgcccgaaatgccacgccaaggaccagtacggcgataac
tgcgaggtctgcggcgccgcttaccagccgaccgagctggtgaacccgttctcggtcttc
accaatgccacgccgatcctgaagccgtccgagcagtacttcttcaagctgtccgatccg
cgctgcttcgaattcctgcgcgactggctgaacacgccaggccgcttgcagccggaaatg
gtcaacaaggtcagtgagtggctgggcgaagccggcgaaaagctggccgactgggatatt
tcgcgcgatgcgccctacttcggcatcccgattccggacgcgccgggcaagttcttctat
gtgtggctggacgcgccggttggctatctggccagcctgaagaattattgcgaaaaacag
ggcatggacttcaacgccctgctgaacgatccggccaccgaacagatccacttcatcggc
aaggatatcgtctccttccacctgctgttctggccggccatgctgaaattcgccgaccat
ccggtgatcgagaagctgaaagtcaatgtgcacggtcacctgaccgtgaacaatgaaaaa
atgtccaagtcgcgcggcaccggcatttcgccgctgcgctacctgaacctgggtatgaat
ccggagtggctgcgctactacatcgccttcaagctcaattccaaggtggaagacctggac
ttcaccggcgacgacttcgtggcgcgcgtgaattccgacctgatcggcaaattcgtcaac
atcgccagccgttgcgccggctttatcgccaagaaattcgacggcaaactggcgagcgaa
ctgtcgccgtcggcccaggactggatcaagcgcgccctgctgtcggccgagggcaaggaa
cgccaggccagcatcgcgcacaacttcgagaaccgcgaattcggcaaggcactgcgcgaa
atcatggaaatcgccgacgccgccaaccagtacgtggacgagaacaagccatgggtgctg
gccaaagacgccgagaaaaccgccgaactgcatgaagtctgcaccacggccctgatcctg
ttccgccagctggccatcctgctgtcgccggtgctgccgggcgtggccgccaatgtgcgc
aaattcctcaaggatgagcgcatggtgtgggccgataccgaagtcgcttccggcgccgtc
tacaagaccatgctgggccgcaccatcggcgcctacgagcatctgatgacccgcgtcgac
gccaagatgatcgaagatctgttcgatgcgcctgcccagcaggctgccgccgcgccggcc
gccgccgaagccgccgcagcagctaccggcatcgaagagctggcgccggaaatcaagatc
gacgatttcgccaagatcgacctgcgcgtggccaagatcgtcaattgcgaacacgtcgaa
ggttccgacaagctgctgcgcctgaccctggatgtgggcgaaggccgccaccgcaatgtc
ttctccggcattaaagcggcttataaaccggaagacctgatcggtaaattgacggtcatg
gtcgccaatctggcgccgcgcaaaatgaaattcggcatttccgaaggcatggtattggct
gcttcggcggcggatgaaaaggccaatcccggcctgtatatcctgaatccatggccgggt
gccgaaccaggcatgcgcatcggctaa

DBGET integrated database retrieval system